BLASTX nr result
ID: Coptis25_contig00001125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00001125 (721 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528989.1| conserved hypothetical protein [Ricinus comm... 55 9e-16 ref|XP_002276745.2| PREDICTED: uncharacterized protein LOC100252... 55 2e-15 ref|NP_195678.1| SAP domain-containing protein [Arabidopsis thal... 56 2e-15 ref|XP_002868923.1| hypothetical protein ARALYDRAFT_912451 [Arab... 56 6e-15 ref|XP_003602011.1| Apoptotic chromatin condensation inducer in ... 54 2e-14 >ref|XP_002528989.1| conserved hypothetical protein [Ricinus communis] gi|223531579|gb|EEF33408.1| conserved hypothetical protein [Ricinus communis] Length = 661 Score = 55.5 bits (132), Expect(2) = 9e-16 Identities = 25/38 (65%), Positives = 33/38 (86%) Frame = +1 Query: 598 EELKRRRLTTKGLKDDLIRRLDESLRAERDTQKEEEVS 711 EELKRR+LTTKGLKDDLI+RLDE+LR ER+ ++ ++ Sbjct: 23 EELKRRKLTTKGLKDDLIKRLDEALRIERENNAKDVIT 60 Score = 53.9 bits (128), Expect(2) = 9e-16 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +3 Query: 456 SSPYPVLDNKPIDQWKVTELKEELKRR 536 SS YP+L+N+PIDQWKVTELKEELKRR Sbjct: 2 SSKYPILENRPIDQWKVTELKEELKRR 28 >ref|XP_002276745.2| PREDICTED: uncharacterized protein LOC100252593 [Vitis vinifera] Length = 691 Score = 54.7 bits (130), Expect(2) = 2e-15 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 456 SSPYPVLDNKPIDQWKVTELKEELKRR 536 SSPY VLDN+PIDQW+VTELKEELKRR Sbjct: 2 SSPYQVLDNRPIDQWRVTELKEELKRR 28 Score = 53.9 bits (128), Expect(2) = 2e-15 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +1 Query: 598 EELKRRRLTTKGLKDDLIRRLDESLRAERDTQKEEEVSN 714 EELKRR+LTTKGLK+DL++RLDE LR ER+ EE+V N Sbjct: 23 EELKRRKLTTKGLKEDLVKRLDEVLRNERE-NAEEDVDN 60 >ref|NP_195678.1| SAP domain-containing protein [Arabidopsis thaliana] gi|145334269|ref|NP_001078515.1| SAP domain-containing protein [Arabidopsis thaliana] gi|3080437|emb|CAA18754.1| putative protein [Arabidopsis thaliana] gi|7270952|emb|CAB80631.1| putative protein [Arabidopsis thaliana] gi|332661703|gb|AEE87103.1| SAP domain-containing protein [Arabidopsis thaliana] gi|332661704|gb|AEE87104.1| SAP domain-containing protein [Arabidopsis thaliana] Length = 633 Score = 56.2 bits (134), Expect(2) = 2e-15 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +3 Query: 453 TSSPYPVLDNKPIDQWKVTELKEELKRR 536 +SSP+PVLDN+PID+WKVTELKEELKRR Sbjct: 2 SSSPFPVLDNRPIDKWKVTELKEELKRR 29 Score = 52.0 bits (123), Expect(2) = 2e-15 Identities = 23/30 (76%), Positives = 30/30 (100%) Frame = +1 Query: 598 EELKRRRLTTKGLKDDLIRRLDESLRAERD 687 EELKRRRLTT+GLK++L+RRLDE+LRAE++ Sbjct: 24 EELKRRRLTTRGLKEELVRRLDEALRAEQE 53 >ref|XP_002868923.1| hypothetical protein ARALYDRAFT_912451 [Arabidopsis lyrata subsp. lyrata] gi|297314759|gb|EFH45182.1| hypothetical protein ARALYDRAFT_912451 [Arabidopsis lyrata subsp. lyrata] Length = 639 Score = 56.2 bits (134), Expect(2) = 6e-15 Identities = 24/28 (85%), Positives = 28/28 (100%) Frame = +3 Query: 453 TSSPYPVLDNKPIDQWKVTELKEELKRR 536 +SSP+PVLDN+PID+WKVTELKEELKRR Sbjct: 2 SSSPFPVLDNRPIDKWKVTELKEELKRR 29 Score = 50.4 bits (119), Expect(2) = 6e-15 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +1 Query: 598 EELKRRRLTTKGLKDDLIRRLDESLRAERD 687 EELKRRRLTT+GLK++L+RRLDE+LR E++ Sbjct: 24 EELKRRRLTTRGLKEELVRRLDEALRVEQE 53 >ref|XP_003602011.1| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] gi|355491059|gb|AES72262.1| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] Length = 720 Score = 54.3 bits (129), Expect(2) = 2e-14 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +3 Query: 447 MKTSSPYPVLDNKPIDQWKVTELKEELKRR 536 M ++S YP+LD+KPID+WKVTELKEELKRR Sbjct: 1 MSSNSKYPILDDKPIDKWKVTELKEELKRR 30 Score = 50.8 bits (120), Expect(2) = 2e-14 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 5/43 (11%) Frame = +1 Query: 598 EELKRRRLTTKGLKDDLIRRLDESLRAERDT-----QKEEEVS 711 EELKRR+L TKGLK+DLI RLDE+LR ER+ +KE+E + Sbjct: 25 EELKRRKLVTKGLKEDLINRLDEALREEREAAEAARKKEQEAA 67