BLASTX nr result
ID: Coptis25_contig00000176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00000176 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513814.1| nucleic acid binding protein, putative [Rici... 55 6e-06 ref|XP_002284394.2| PREDICTED: uncharacterized protein LOC100257... 55 8e-06 >ref|XP_002513814.1| nucleic acid binding protein, putative [Ricinus communis] gi|223546900|gb|EEF48397.1| nucleic acid binding protein, putative [Ricinus communis] Length = 441 Score = 55.1 bits (131), Expect = 6e-06 Identities = 36/81 (44%), Positives = 42/81 (51%) Frame = -3 Query: 243 VMQRPETCSLDDSKKWASLATCNSVGSASSRSMRAPLSEINXXXXXXXXXXXXXXXXXXX 64 VM RPET S + +K AS+A +S ASSRSM+APLSEI+ Sbjct: 105 VMHRPETASPELQRKRASMALTSSSNGASSRSMKAPLSEIS--NGVLSSTNSSLSASSNS 162 Query: 63 XXXXXXXSFRGMQFRRLSGCY 1 SFRGM FRR SGCY Sbjct: 163 SSMSNAGSFRGMPFRRFSGCY 183 >ref|XP_002284394.2| PREDICTED: uncharacterized protein LOC100257501 [Vitis vinifera] Length = 420 Score = 54.7 bits (130), Expect = 8e-06 Identities = 36/81 (44%), Positives = 42/81 (51%) Frame = -3 Query: 243 VMQRPETCSLDDSKKWASLATCNSVGSASSRSMRAPLSEINXXXXXXXXXXXXXXXXXXX 64 VM RPE S +D KK S+A+ N+ GS SRSM+APLSE+N Sbjct: 88 VMHRPEMSSPEDHKKRPSMASSNNDGS--SRSMKAPLSELNGVVSSTSSSLSISASSNSS 145 Query: 63 XXXXXXXSFRGMQFRRLSGCY 1 FRGM FRRLSGCY Sbjct: 146 VGGS----FRGMPFRRLSGCY 162