BLASTX nr result
ID: Coptis24_contig00039487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00039487 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 117 1e-24 ref|XP_002539361.1| conserved hypothetical protein [Ricinus comm... 53 4e-08 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 117 bits (293), Expect = 1e-24 Identities = 58/63 (92%), Positives = 58/63 (92%) Frame = +2 Query: 86 QAVDSFIREGKKGPKHGRCRTLECQRKARPYLFFQACSDIRFPRKIKLVSRVMGNLLARF 265 QAVDSFIREGKKGPKH RCRTLE QRKA YLFFQACSDIRFPRKIKLVSRVMGNL ARF Sbjct: 121 QAVDSFIREGKKGPKHLRCRTLEWQRKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARF 180 Query: 266 GEH 274 GEH Sbjct: 181 GEH 183 >ref|XP_002539361.1| conserved hypothetical protein [Ricinus communis] gi|223506854|gb|EEF23023.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 139 MPYT*VPKESETVPVFPGLFGHTVPAEDQVGEPCDGKPSRT 261 MPYT +++ + +F GHTVPAEDQVGEPCDGKPSRT Sbjct: 1 MPYTEWQRKAGSY-LFSRPVGHTVPAEDQVGEPCDGKPSRT 40 Score = 29.6 bits (65), Expect(2) = 4e-08 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 318 GSSLNSQIGPTRNS 359 GSSL+SQIGPTRNS Sbjct: 41 GSSLDSQIGPTRNS 54