BLASTX nr result
ID: Coptis24_contig00038742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00038742 (523 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [S... 70 4e-12 emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] 66 3e-09 ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medica... 52 1e-07 >ref|XP_002451896.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] gi|241931727|gb|EES04872.1| hypothetical protein SORBIDRAFT_04g009491 [Sorghum bicolor] Length = 289 Score = 69.7 bits (169), Expect(2) = 4e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 114 YACIFRLDSRIFCFSGGGEQCCLRCGRCPP 203 YAC+FRLDSRIFCFSGGGEQC LRCGRCPP Sbjct: 239 YACLFRLDSRIFCFSGGGEQCSLRCGRCPP 268 Score = 26.2 bits (56), Expect(2) = 4e-12 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 86 RRPLSLDHYLCMY 124 R PLSLDHY C++ Sbjct: 231 RGPLSLDHYACLF 243 >emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera] Length = 280 Score = 66.2 bits (160), Expect = 3e-09 Identities = 43/84 (51%), Positives = 46/84 (54%), Gaps = 8/84 (9%) Frame = +3 Query: 132 LDSRIFCFSGGGEQCCLRCGRCP-------PERTAH*LGGLVGGGPNRRKPCLSNHQ-RM 287 LDSRIFCFSGGGEQC LRCGRCP P R L GGP RR NH R Sbjct: 52 LDSRIFCFSGGGEQCSLRCGRCPPVGPGLLPARKNRSLASRTSGGPIRRH--TENHAFRT 109 Query: 288 SRV*R**LVSPVFKIKKNGLIGKK 359 R R + K KKNGL+GK+ Sbjct: 110 ERNAR------LPKKKKNGLVGKR 127 >ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477316|gb|AES58519.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 556 Score = 51.6 bits (122), Expect(2) = 1e-07 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 205 SGGHLPQRKQHCSPPPEKQKIRES 134 +GGHLPQRK HCSPPP+KQKIRES Sbjct: 294 TGGHLPQRKLHCSPPPDKQKIRES 317 Score = 28.9 bits (63), Expect(2) = 1e-07 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -2 Query: 237 PLVRLASERFFRA 199 PLVRLASERFFRA Sbjct: 275 PLVRLASERFFRA 287