BLASTX nr result
ID: Coptis24_contig00037865
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037865 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_004138984.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] gi|449477884|ref|XP_004155152.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial-like [Cucumis sativus] Length = 479 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/73 (42%), Positives = 48/73 (65%) Frame = -3 Query: 224 SVVVKQKVFEETPERTNEQVVKVVSVLRNASLAVNGFLESSLGKLELTINEEFMVRVIET 45 +VVV + EE E V ++ SVL V+G ESSL ++ LT+NE+F+++VIET Sbjct: 13 NVVVSDGIGEEV-ESYGVNVEQLESVLSLIQSTVDGSFESSLDEMRLTLNEDFVLKVIET 71 Query: 44 PLVPGDSLIRFYK 6 P + G++LIRF++ Sbjct: 72 PHILGENLIRFFR 84