BLASTX nr result
ID: Coptis24_contig00037777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037777 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632560.1| PREDICTED: uncharacterized protein LOC100854... 64 1e-08 ref|XP_002322766.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002524097.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 ref|XP_002309265.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_002879580.1| hypothetical protein ARALYDRAFT_482556 [Arab... 55 6e-06 >ref|XP_003632560.1| PREDICTED: uncharacterized protein LOC100854533 [Vitis vinifera] gi|296089347|emb|CBI39119.3| unnamed protein product [Vitis vinifera] Length = 120 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 2/40 (5%) Frame = -1 Query: 114 MESSAG--VGFMAVFAVSGSVVLVAMQLHKRLLSDFMKKV 1 ME SAG VGFMAVFAVSGS VL+A+QLHKRLLSDFMKK+ Sbjct: 1 MEGSAGIGVGFMAVFAVSGSAVLIALQLHKRLLSDFMKKI 40 >ref|XP_002322766.1| predicted protein [Populus trichocarpa] gi|222867396|gb|EEF04527.1| predicted protein [Populus trichocarpa] Length = 99 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 114 MESSAGVGFMAVFAVSGSVVLVAMQLHKRLLSDFMKKV 1 M+ S G+GFMA FAVSGSVVL+A Q+HKRLLSDFMKK+ Sbjct: 1 MQGSMGLGFMAAFAVSGSVVLIARQVHKRLLSDFMKKM 38 >ref|XP_002524097.1| conserved hypothetical protein [Ricinus communis] gi|223536665|gb|EEF38307.1| conserved hypothetical protein [Ricinus communis] Length = 145 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = -1 Query: 108 SSAGVGFMAVFAVSGSVVLVAMQLHKRLLSDFMKKV 1 S+ G+GFMA FAVSGSVVL+A Q+HKRL+SDFMKK+ Sbjct: 8 STMGLGFMAAFAVSGSVVLIARQVHKRLVSDFMKKI 43 >ref|XP_002309265.1| predicted protein [Populus trichocarpa] gi|222855241|gb|EEE92788.1| predicted protein [Populus trichocarpa] Length = 89 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 114 MESSAGVGFMAVFAVSGSVVLVAMQLHKRLLSDFMKKV 1 M G+GFMA FAVSGS+VL+A QLHKRLLSDFMK++ Sbjct: 1 MAGYLGIGFMAAFAVSGSLVLIARQLHKRLLSDFMKQM 38 >ref|XP_002879580.1| hypothetical protein ARALYDRAFT_482556 [Arabidopsis lyrata subsp. lyrata] gi|297325419|gb|EFH55839.1| hypothetical protein ARALYDRAFT_482556 [Arabidopsis lyrata subsp. lyrata] Length = 82 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 114 MESSAGVGFMAVFAVSGSVVLVAMQLHKRLLSDFMKKV 1 MESS +GFM VFAVSGSVVL+A QLHKRLLSD+M K+ Sbjct: 1 MESS--IGFMTVFAVSGSVVLLAAQLHKRLLSDYMDKL 36