BLASTX nr result
ID: Coptis24_contig00037584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037584 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] 55 4e-08 ref|NP_193274.1| HXXXD-type acyl-transferase family protein [Ara... 55 4e-06 dbj|BAF02069.1| HSR201 like protein [Arabidopsis thaliana] 55 4e-06 ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, p... 54 1e-05 >gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa] Length = 424 Score = 55.5 bits (132), Expect(2) = 4e-08 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = +3 Query: 108 KLTFCDCSGMAIAIGVSLSHSIADATSLGTFVISWAAIA*GDNEIATPIFFGFASLFP 281 +++ DC G IAIGV++SH+ DA+SL F+ SWAA A G NEI P FGF LFP Sbjct: 129 QVSLFDCGG--IAIGVTISHTAGDASSLTAFINSWAATAKGANEIVPP-KFGFDYLFP 183 Score = 26.6 bits (57), Expect(2) = 4e-08 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +2 Query: 2 LRQVLNYPEADQLHQLLPCNIRESNWLGVEGLSAVQANI 118 L Q+L P+AD+L+QL+P + + LSAVQ ++ Sbjct: 103 LSQLLGCPKADELNQLIPFS---------QKLSAVQVSL 132 >ref|NP_193274.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana] gi|2244896|emb|CAB10318.1| HSR201 like protein [Arabidopsis thaliana] gi|7268286|emb|CAB78581.1| HSR201 like protein [Arabidopsis thaliana] gi|20466572|gb|AAM20603.1| HSR201 like protein [Arabidopsis thaliana] gi|22136378|gb|AAM91267.1| HSR201-like protein [Arabidopsis thaliana] gi|332658191|gb|AEE83591.1| HXXXD-type acyl-transferase family protein [Arabidopsis thaliana] Length = 446 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = +3 Query: 102 LFKLTFCDCSGMAIAIGVSLSHSIADATSLGTFVISWAAIA*GDNEIA---TPIFFGFAS 272 L K T+ C GMAI G+ ++H IADA S+ TF+ SWAA A G+N+ A +P+F G A+ Sbjct: 141 LVKATYFGCGGMAI--GICITHKIADAASISTFIRSWAATARGENDAAAMESPVFAG-AN 197 Query: 273 LFP 281 +P Sbjct: 198 FYP 200 >dbj|BAF02069.1| HSR201 like protein [Arabidopsis thaliana] Length = 458 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 3/63 (4%) Frame = +3 Query: 102 LFKLTFCDCSGMAIAIGVSLSHSIADATSLGTFVISWAAIA*GDNEIA---TPIFFGFAS 272 L K T+ C GMAI G+ ++H IADA S+ TF+ SWAA A G+N+ A +P+F G A+ Sbjct: 153 LVKATYFGCGGMAI--GICITHKIADAASISTFIRSWAATARGENDAAAMESPVFAG-AN 209 Query: 273 LFP 281 +P Sbjct: 210 FYP 212 >ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus communis] gi|223546034|gb|EEF47537.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus communis] Length = 442 Score = 54.3 bits (129), Expect = 1e-05 Identities = 27/60 (45%), Positives = 40/60 (66%) Frame = +3 Query: 102 LFKLTFCDCSGMAIAIGVSLSHSIADATSLGTFVISWAAIA*GDNEIATPIFFGFASLFP 281 L + TF DC G+A+ G+ +SH +ADA +L TF+ W+A A ++I P+F G AS+FP Sbjct: 144 LVQATFFDCGGLAV--GICISHKMADAATLTTFIRCWSATATDRSKILNPVFMG-ASIFP 200