BLASTX nr result
ID: Coptis24_contig00037239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037239 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61843.1| hypothetical protein VITISV_004818 [Vitis vinifera] 64 1e-08 ref|XP_002516739.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 >emb|CAN61843.1| hypothetical protein VITISV_004818 [Vitis vinifera] Length = 220 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +3 Query: 3 KGCGG--IVRKSYASIEDLKGLGSSVSSAINGEGKGVGRSFRGIQKTVLGYRQY 158 KG GG + RKSYAS+E+LKG S+ ++AINGE +G + RGI KTVLGYRQY Sbjct: 167 KGGGGGLMARKSYASVEELKGFSSAAANAINGENRGGRTNNRGIGKTVLGYRQY 220 >ref|XP_002516739.1| conserved hypothetical protein [Ricinus communis] gi|223544112|gb|EEF45637.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/49 (61%), Positives = 38/49 (77%) Frame = +3 Query: 12 GGIVRKSYASIEDLKGLGSSVSSAINGEGKGVGRSFRGIQKTVLGYRQY 158 G + RKSYAS+E+LKGL + ++AINGE +G R RGI KTVLGYRQ+ Sbjct: 155 GLMARKSYASLEELKGLSMAAATAINGESRG-RRGGRGIGKTVLGYRQF 202