BLASTX nr result
ID: Coptis24_contig00037000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037000 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514555.1| menaquinone biosynthesis protein, putative [... 57 1e-06 >ref|XP_002514555.1| menaquinone biosynthesis protein, putative [Ricinus communis] gi|223546159|gb|EEF47661.1| menaquinone biosynthesis protein, putative [Ricinus communis] Length = 1679 Score = 57.4 bits (137), Expect = 1e-06 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 5/97 (5%) Frame = -3 Query: 281 LNLPNNKKRIQHSPKSRPIYLHSHFLPFRKHTSNFKLIIR-----GMSSSVDNVESINDD 117 LNL K+ +HSP + + PFR + N K+I+ G D +E+ D Sbjct: 18 LNLQFRVKKSRHSPSF--LAFLNRTAPFRFNLLNSKVIMEAVRYDGPIIDFDELEADKDC 75 Query: 116 LSPVEICYTRTLPPALTLEHGFVKIEEEVDKLISNPP 6 +E C TRTL PALTLEHG ++E V++L NPP Sbjct: 76 EVVIETCITRTLTPALTLEHGLRSVKEAVEELKLNPP 112