BLASTX nr result
ID: Coptis24_contig00036995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036995 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274917.2| PREDICTED: dihydroorotase, mitochondrial-lik... 149 2e-34 emb|CBI21866.3| unnamed protein product [Vitis vinifera] 149 2e-34 ref|XP_002517898.1| Dihydroorotase, mitochondrial precursor, put... 146 1e-33 ref|XP_002869797.1| mitochondrial dihydroorotase [Arabidopsis ly... 146 2e-33 ref|NP_194024.1| dihydroorotase [Arabidopsis thaliana] gi|250003... 146 2e-33 >ref|XP_002274917.2| PREDICTED: dihydroorotase, mitochondrial-like [Vitis vinifera] Length = 377 Score = 149 bits (376), Expect = 2e-34 Identities = 72/83 (86%), Positives = 79/83 (95%) Frame = +1 Query: 1 PVLKEMVEQNMPLLVHGEVTDPEVDMFDREKVFIETILRPLIKKLPDLKVVMEHITTQDA 180 PVL+EMVEQNMPLLVHGEVT+PEVD+FDREKVFIET+LRPLI+K P LKVVMEHITT DA Sbjct: 152 PVLEEMVEQNMPLLVHGEVTNPEVDVFDREKVFIETVLRPLIQKFPRLKVVMEHITTMDA 211 Query: 181 VRFIESCKEGSVAATVTPQHLLL 249 VRF+ESC EGSVAATVTPQHL+L Sbjct: 212 VRFVESCNEGSVAATVTPQHLVL 234 >emb|CBI21866.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 149 bits (376), Expect = 2e-34 Identities = 72/83 (86%), Positives = 79/83 (95%) Frame = +1 Query: 1 PVLKEMVEQNMPLLVHGEVTDPEVDMFDREKVFIETILRPLIKKLPDLKVVMEHITTQDA 180 PVL+EMVEQNMPLLVHGEVT+PEVD+FDREKVFIET+LRPLI+K P LKVVMEHITT DA Sbjct: 121 PVLEEMVEQNMPLLVHGEVTNPEVDVFDREKVFIETVLRPLIQKFPRLKVVMEHITTMDA 180 Query: 181 VRFIESCKEGSVAATVTPQHLLL 249 VRF+ESC EGSVAATVTPQHL+L Sbjct: 181 VRFVESCNEGSVAATVTPQHLVL 203 >ref|XP_002517898.1| Dihydroorotase, mitochondrial precursor, putative [Ricinus communis] gi|223542880|gb|EEF44416.1| Dihydroorotase, mitochondrial precursor, putative [Ricinus communis] Length = 398 Score = 146 bits (369), Expect = 1e-33 Identities = 70/83 (84%), Positives = 79/83 (95%) Frame = +1 Query: 1 PVLKEMVEQNMPLLVHGEVTDPEVDMFDREKVFIETILRPLIKKLPDLKVVMEHITTQDA 180 PVL+EMVEQNMPLLVHGEVTDP VD+FDREKVFI+T+L+PLI+KLP LKVVMEHITT DA Sbjct: 173 PVLEEMVEQNMPLLVHGEVTDPSVDIFDREKVFIDTVLQPLIQKLPRLKVVMEHITTMDA 232 Query: 181 VRFIESCKEGSVAATVTPQHLLL 249 VRF++SC EGSVAATVTPQHL+L Sbjct: 233 VRFVQSCDEGSVAATVTPQHLVL 255 >ref|XP_002869797.1| mitochondrial dihydroorotase [Arabidopsis lyrata subsp. lyrata] gi|297315633|gb|EFH46056.1| mitochondrial dihydroorotase [Arabidopsis lyrata subsp. lyrata] Length = 378 Score = 146 bits (368), Expect = 2e-33 Identities = 68/83 (81%), Positives = 78/83 (93%) Frame = +1 Query: 1 PVLKEMVEQNMPLLVHGEVTDPEVDMFDREKVFIETILRPLIKKLPDLKVVMEHITTQDA 180 PVL+EMV+QNMPLLVHGEVTDP +D+FDREK+FIET+L+PLI++LP LKVVMEHITT DA Sbjct: 154 PVLEEMVKQNMPLLVHGEVTDPSIDVFDREKIFIETVLQPLIQRLPQLKVVMEHITTMDA 213 Query: 181 VRFIESCKEGSVAATVTPQHLLL 249 V F+ESCKEGSV ATVTPQHLLL Sbjct: 214 VNFVESCKEGSVGATVTPQHLLL 236 >ref|NP_194024.1| dihydroorotase [Arabidopsis thaliana] gi|2500036|sp|O04904.1|PYRC_ARATH RecName: Full=Dihydroorotase, mitochondrial; Short=DHOase; Flags: Precursor gi|2121273|gb|AAB71134.1| dihydroorotase [Arabidopsis thaliana] gi|3292818|emb|CAA19808.1| dihydroorotase [Arabidopsis thaliana] gi|7269140|emb|CAB79248.1| dihydroorotase [Arabidopsis thaliana] gi|332659282|gb|AEE84682.1| dihydroorotase [Arabidopsis thaliana] Length = 377 Score = 146 bits (368), Expect = 2e-33 Identities = 68/83 (81%), Positives = 78/83 (93%) Frame = +1 Query: 1 PVLKEMVEQNMPLLVHGEVTDPEVDMFDREKVFIETILRPLIKKLPDLKVVMEHITTQDA 180 PVL+EMV+QNMPLLVHGEVTDP +D+FDREK+FIET+L+PLI++LP LKVVMEHITT DA Sbjct: 153 PVLEEMVKQNMPLLVHGEVTDPSIDVFDREKIFIETVLQPLIQRLPQLKVVMEHITTMDA 212 Query: 181 VRFIESCKEGSVAATVTPQHLLL 249 V F+ESCKEGSV ATVTPQHLLL Sbjct: 213 VNFVESCKEGSVGATVTPQHLLL 235