BLASTX nr result
ID: Coptis24_contig00036610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036610 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22616.3| unnamed protein product [Vitis vinifera] 98 8e-19 ref|XP_002276766.1| PREDICTED: ABC transporter G family member 8... 98 8e-19 ref|XP_002513627.1| ATP-binding cassette transporter, putative [... 97 2e-18 ref|XP_003556131.1| PREDICTED: LOW QUALITY PROTEIN: ABC transpor... 91 8e-17 ref|XP_002329680.1| white-brown-complex ABC transporter family [... 91 1e-16 >emb|CBI22616.3| unnamed protein product [Vitis vinifera] Length = 583 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -2 Query: 173 RPCTASPPTYILRDISFTAHPSQVLAIVGPSGAGKSTLLDILAARISPTYGTLLLNS 3 +PCT +PPTYILRDI TA+PSQVLAIVGPSGAGKSTLLDILAAR SPT G+LLLNS Sbjct: 49 QPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNS 105 >ref|XP_002276766.1| PREDICTED: ABC transporter G family member 8-like [Vitis vinifera] Length = 597 Score = 97.8 bits (242), Expect = 8e-19 Identities = 48/57 (84%), Positives = 52/57 (91%) Frame = -2 Query: 173 RPCTASPPTYILRDISFTAHPSQVLAIVGPSGAGKSTLLDILAARISPTYGTLLLNS 3 +PCT +PPTYILRDI TA+PSQVLAIVGPSGAGKSTLLDILAAR SPT G+LLLNS Sbjct: 41 QPCTTTPPTYILRDICLTAYPSQVLAIVGPSGAGKSTLLDILAARTSPTSGSLLLNS 97 >ref|XP_002513627.1| ATP-binding cassette transporter, putative [Ricinus communis] gi|223547535|gb|EEF49030.1| ATP-binding cassette transporter, putative [Ricinus communis] Length = 442 Score = 96.7 bits (239), Expect = 2e-18 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -2 Query: 167 CTASPPTYILRDISFTAHPSQVLAIVGPSGAGKSTLLDILAARISPTYGTLLLNS 3 CT +PPTYILRD+SFTA+PSQ+LAIVGPSGAGKS+LLDILAAR SPT GTLL NS Sbjct: 64 CTTTPPTYILRDVSFTAYPSQILAIVGPSGAGKSSLLDILAARTSPTSGTLLFNS 118 >ref|XP_003556131.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 8-like [Glycine max] Length = 601 Score = 91.3 bits (225), Expect = 8e-17 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -2 Query: 167 CTASPPTYILRDISFTAHPSQVLAIVGPSGAGKSTLLDILAARISPTYGTLLLNS 3 CT +PPTYIL+DIS TA PSQ+LA+VGPSGAGKSTLLDILAAR P++GTLLLNS Sbjct: 41 CTNTPPTYILKDISLTALPSQILAVVGPSGAGKSTLLDILAARTLPSHGTLLLNS 95 >ref|XP_002329680.1| white-brown-complex ABC transporter family [Populus trichocarpa] gi|222870588|gb|EEF07719.1| white-brown-complex ABC transporter family [Populus trichocarpa] Length = 593 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/57 (73%), Positives = 51/57 (89%) Frame = -2 Query: 173 RPCTASPPTYILRDISFTAHPSQVLAIVGPSGAGKSTLLDILAARISPTYGTLLLNS 3 + CT +PP+YIL+++S TA+PSQ+LA+VGPSGAGKSTLLDILAAR SPT G LLLNS Sbjct: 37 KQCTTTPPSYILKEVSLTAYPSQILAVVGPSGAGKSTLLDILAARTSPTSGILLLNS 93