BLASTX nr result
ID: Coptis24_contig00036516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036516 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270571.2| PREDICTED: ribulose bisphosphate carboxylase... 69 3e-10 ref|XP_002532996.1| Ribulose bisphosphate carboxylase/oxygenase ... 69 4e-10 gb|ADK70390.1| rubisco activase [Musa AB Group] 68 9e-10 ref|XP_002524206.1| Ribulose bisphosphate carboxylase/oxygenase ... 67 1e-09 ref|XP_003616450.1| Ribulose-1 5-bisphosphate carboxylase/oxygen... 67 2e-09 >ref|XP_002270571.2| PREDICTED: ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplastic-like [Vitis vinifera] gi|297740331|emb|CBI30513.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +1 Query: 154 SAQQVNVPVPEGRTDPSATNFDPTARSDDGSCLYQ 258 +AQQVN+PVPEG TDPSA NFDPTARSDDGSCLYQ Sbjct: 439 AAQQVNLPVPEGCTDPSANNFDPTARSDDGSCLYQ 473 >ref|XP_002532996.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] gi|223527225|gb|EEF29388.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] Length = 474 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +1 Query: 154 SAQQVNVPVPEGRTDPSATNFDPTARSDDGSCLYQF 261 +AQQV VPVPEG TDPSA NFDPTARSDDGSCLY+F Sbjct: 439 AAQQVKVPVPEGCTDPSAENFDPTARSDDGSCLYEF 474 >gb|ADK70390.1| rubisco activase [Musa AB Group] Length = 68 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +1 Query: 154 SAQQVNVPVPEGRTDPSATNFDPTARSDDGSCLY 255 +AQQVN+PVPEG TDP ATNFDPTARSDDGSCLY Sbjct: 35 AAQQVNIPVPEGCTDPIATNFDPTARSDDGSCLY 68 >ref|XP_002524206.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] gi|223536483|gb|EEF38130.1| Ribulose bisphosphate carboxylase/oxygenase activase 1, chloroplast precursor, putative [Ricinus communis] Length = 473 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +1 Query: 154 SAQQVNVPVPEGRTDPSATNFDPTARSDDGSCLYQF 261 +AQQVN+PVPEG TDP+A NFDPTARSDDGSC Y+F Sbjct: 438 AAQQVNIPVPEGCTDPTAQNFDPTARSDDGSCTYKF 473 >ref|XP_003616450.1| Ribulose-1 5-bisphosphate carboxylase/oxygenase activase [Medicago truncatula] gi|355517785|gb|AES99408.1| Ribulose-1 5-bisphosphate carboxylase/oxygenase activase [Medicago truncatula] Length = 476 Score = 67.0 bits (162), Expect = 2e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +1 Query: 154 SAQQVNVPVPEGRTDPSATNFDPTARSDDGSCLYQF 261 +AQQVN+P+PEG TDP+A NFDPTARSDDG+CLY F Sbjct: 440 AAQQVNIPIPEGCTDPNAKNFDPTARSDDGTCLYTF 475