BLASTX nr result
ID: Coptis24_contig00036510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036510 (639 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004175646.1| putative LysR family transcriptional regulat... 57 2e-06 ref|ZP_21238621.1| hypothetical protein D187_01367 [Cystobacter ... 57 4e-06 >ref|YP_004175646.1| putative LysR family transcriptional regulator [Anaerolinea thermophila UNI-1] gi|319996275|dbj|BAJ65046.1| putative LysR family transcriptional regulator [Anaerolinea thermophila UNI-1] Length = 455 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/61 (40%), Positives = 33/61 (54%) Frame = -1 Query: 189 YGCVAFDSKIYFIGGMSDDCYSSKVFIFDPATNTWKEGAPLNHPRAFPTVVAIGRRIYVF 10 Y AF+ +Y GG SS V+ +DP TN W+E PL PR F +A+ RI +F Sbjct: 264 YALTAFEGNLYLFGGWDGKTPSSAVYAYDPETNRWEERTPLPSPRVFAAAIAVEGRILLF 323 Query: 9 G 7 G Sbjct: 324 G 324 >ref|ZP_21238621.1| hypothetical protein D187_01367 [Cystobacter fuscus DSM 2262] gi|444709731|gb|ELW50731.1| hypothetical protein D187_01367 [Cystobacter fuscus DSM 2262] Length = 334 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/61 (40%), Positives = 36/61 (59%) Frame = -1 Query: 189 YGCVAFDSKIYFIGGMSDDCYSSKVFIFDPATNTWKEGAPLNHPRAFPTVVAIGRRIYVF 10 +G VA K+Y I G+ D + +V ++DP +NTW E APL P P + +G +IYV Sbjct: 52 HGVVALGGKVYVIAGV-DTANTGRVSVYDPPSNTWSEAAPLPLPMNHPNIAVVGEKIYVV 110 Query: 9 G 7 G Sbjct: 111 G 111