BLASTX nr result
ID: Coptis24_contig00036472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036472 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166074.1| PREDICTED: acyl carrier protein 3, mitochond... 43 5e-09 ref|XP_004139528.1| PREDICTED: acyl carrier protein 3, mitochond... 43 5e-09 ref|NP_001146852.1| acyl carrier protein [Zea mays] gi|195604234... 43 8e-09 emb|CBI18638.3| unnamed protein product [Vitis vinifera] 44 1e-08 ref|XP_002464270.1| hypothetical protein SORBIDRAFT_01g015260 [S... 44 1e-08 >ref|XP_004166074.1| PREDICTED: acyl carrier protein 3, mitochondrial-like [Cucumis sativus] Length = 138 Score = 43.1 bits (100), Expect(2) = 5e-09 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 90 RNFPLRSPEEVADKFTCCADVAKYFTSEAE 1 + F + PEE ADK TCCADVA+Y TS+ E Sbjct: 102 QEFSIDIPEEQADKLTCCADVARYITSQVE 131 Score = 42.4 bits (98), Expect(2) = 5e-09 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 145 KQLIFDSLDRVKLVMTFEQEFSIEIP 68 K L DSLDRV+LVM FEQEFSI+IP Sbjct: 84 KDLSLDSLDRVELVMAFEQEFSIDIP 109 >ref|XP_004139528.1| PREDICTED: acyl carrier protein 3, mitochondrial-like [Cucumis sativus] Length = 130 Score = 43.1 bits (100), Expect(2) = 5e-09 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 90 RNFPLRSPEEVADKFTCCADVAKYFTSEAE 1 + F + PEE ADK TCCADVA+Y TS+ E Sbjct: 94 QEFSIDIPEEQADKLTCCADVARYITSQVE 123 Score = 42.4 bits (98), Expect(2) = 5e-09 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 145 KQLIFDSLDRVKLVMTFEQEFSIEIP 68 K L DSLDRV+LVM FEQEFSI+IP Sbjct: 76 KDLSLDSLDRVELVMAFEQEFSIDIP 101 >ref|NP_001146852.1| acyl carrier protein [Zea mays] gi|195604234|gb|ACG23947.1| acyl carrier protein [Zea mays] gi|414871660|tpg|DAA50217.1| TPA: acyl carrier protein [Zea mays] Length = 136 Score = 43.1 bits (100), Expect(2) = 8e-09 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 145 KQLIFDSLDRVKLVMTFEQEFSIEIP 68 K L DSLDRV+LVM FEQEFS+EIP Sbjct: 80 KDLSLDSLDRVELVMAFEQEFSVEIP 105 Score = 41.6 bits (96), Expect(2) = 8e-09 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -3 Query: 90 RNFPLRSPEEVADKFTCCADVAKYFTSEAE 1 + F + P++ ADK TCCADVAKY SE+E Sbjct: 98 QEFSVEIPDDKADKLTCCADVAKYIISESE 127 >emb|CBI18638.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 43.9 bits (102), Expect(2) = 1e-08 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -2 Query: 169 TSTFNGLLKQLIFDSLDRVKLVMTFEQEFSIEIP 68 T+T N K L DSLDRV+LVM FEQEFS+EIP Sbjct: 122 TATAN-FQKDLCLDSLDRVELVMAFEQEFSVEIP 154 Score = 40.4 bits (93), Expect(2) = 1e-08 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = -3 Query: 90 RNFPLRSPEEVADKFTCCADVAKYFTSEAE 1 + F + PEE ADK TCCADVA+Y S A+ Sbjct: 147 QEFSVEIPEEEADKLTCCADVARYIVSGAQ 176 >ref|XP_002464270.1| hypothetical protein SORBIDRAFT_01g015260 [Sorghum bicolor] gi|241918124|gb|EER91268.1| hypothetical protein SORBIDRAFT_01g015260 [Sorghum bicolor] Length = 142 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 145 KQLIFDSLDRVKLVMTFEQEFSIEIP 68 K L DSLDRV+LVM FEQEFSIEIP Sbjct: 86 KDLSLDSLDRVELVMAFEQEFSIEIP 111 Score = 40.8 bits (94), Expect(2) = 1e-08 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = -3 Query: 90 RNFPLRSPEEVADKFTCCADVAKYFTSEAE 1 + F + P++ ADK TCCADVAKY SE++ Sbjct: 104 QEFSIEIPDDKADKLTCCADVAKYIISESQ 133