BLASTX nr result
ID: Coptis24_contig00036292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036292 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161272.1| PREDICTED: wall-associated receptor kinase-l... 67 2e-09 ref|XP_004137999.1| PREDICTED: wall-associated receptor kinase-l... 67 2e-09 ref|XP_002264481.2| PREDICTED: wall-associated receptor kinase-l... 65 4e-09 emb|CBI30203.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002519414.1| serine-threonine protein kinase, plant-type,... 65 4e-09 >ref|XP_004161272.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis sativus] Length = 635 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 172 QIMCPKCGSMEVPYPLSTSSNCGDPDYGLHCDAHTHKLY 288 Q CP+CGS EVPYPLST+ NCGD DY L CD+H+ KLY Sbjct: 26 QKTCPRCGSFEVPYPLSTNPNCGDLDYALRCDSHSKKLY 64 >ref|XP_004137999.1| PREDICTED: wall-associated receptor kinase-like 20-like [Cucumis sativus] Length = 641 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +1 Query: 172 QIMCPKCGSMEVPYPLSTSSNCGDPDYGLHCDAHTHKLY 288 Q CP+CGS EVPYPLST+ NCGD DY L CD+H+ KLY Sbjct: 26 QKTCPRCGSFEVPYPLSTNPNCGDLDYALRCDSHSKKLY 64 >ref|XP_002264481.2| PREDICTED: wall-associated receptor kinase-like 20-like [Vitis vinifera] Length = 639 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 181 CPKCGSMEVPYPLSTSSNCGDPDYGLHCDAHTHKLY 288 CP CGS++VPYPLST+ NCGDPDY L CD + KLY Sbjct: 32 CPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLY 67 >emb|CBI30203.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 65.5 bits (158), Expect = 4e-09 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = +1 Query: 181 CPKCGSMEVPYPLSTSSNCGDPDYGLHCDAHTHKLY 288 CP CGS++VPYPLST+ NCGDPDY L CD + KLY Sbjct: 32 CPNCGSIQVPYPLSTNPNCGDPDYSLRCDGDSQKLY 67 >ref|XP_002519414.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223541277|gb|EEF42828.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 669 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +1 Query: 172 QIMCPKCGSMEVPYPLSTSSNCGDPDYGLHCDAHTHKLY 288 Q CP CG MEVPYPLST+ +CGDP+Y L CD+H+ KLY Sbjct: 59 QKTCPNCGFMEVPYPLSTNPSCGDPNYHLRCDSHSQKLY 97