BLASTX nr result
ID: Coptis24_contig00036223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036223 (475 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_002520999.1| pentatricopeptide repeat-containing protein,... 71 8e-11 ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_004151739.1| PREDICTED: pentatricopeptide repeat-containi... 57 1e-06 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 80.9 bits (198), Expect = 1e-13 Identities = 41/63 (65%), Positives = 51/63 (80%), Gaps = 1/63 (1%) Frame = +2 Query: 14 NVVTFNTLMRGFL-NEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREYLNSF 190 N+VTFNTLMRGF N+E QKVV+ L +M +K+ PDAST +IV++LLSKDEK REYL+ Sbjct: 552 NLVTFNTLMRGFCQNDEMQKVVELLQEMAEKDFSPDASTISIVVDLLSKDEKYREYLHLL 611 Query: 191 PTF 199 PTF Sbjct: 612 PTF 614 >ref|XP_002520999.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539836|gb|EEF41416.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 628 Score = 71.2 bits (173), Expect = 8e-11 Identities = 38/63 (60%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = +2 Query: 14 NVVTFNTLMRGF-LNEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREYLNSF 190 NVVTFNTLMRG LN E K+V+ LHKM + L PDAST IV+++L KDE E LN Sbjct: 560 NVVTFNTLMRGLCLNSERPKIVELLHKMAARKLSPDASTLLIVMDILLKDENYHECLNLL 619 Query: 191 PTF 199 PTF Sbjct: 620 PTF 622 >ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = +2 Query: 14 NVVTFNTLMRGFLNEEP-QKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREYLNSF 190 +++T+NTLMRGF ++VVQ LH+M K++ PDA T +IV+++LSKDEK +E L+ Sbjct: 529 DIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQECLHLL 588 Query: 191 PTF 199 P F Sbjct: 589 PRF 591 >ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 580 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/63 (49%), Positives = 46/63 (73%), Gaps = 1/63 (1%) Frame = +2 Query: 14 NVVTFNTLMRGFLNEEP-QKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREYLNSF 190 +++T+NTLMRGF ++VVQ LH+M K++ PDA T +IV+++LSKDEK +E L+ Sbjct: 504 DIITYNTLMRGFYESNKLEEVVQLLHRMAQKDVSPDAITCSIVVDMLSKDEKYQECLHLL 563 Query: 191 PTF 199 P F Sbjct: 564 PRF 566 >ref|XP_004151739.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 225 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/69 (40%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +2 Query: 14 NVVTFNTLMRGFL-NEEPQKVVQHLHKMRDKNLRPDASTAAIVIELLSKDEKSREYLNSF 190 +++T+NTL+ GF + + +VV+ LHKM +++ PDA + IVI++L KDEK +E L+ Sbjct: 155 DIITYNTLLCGFCQSNKSDEVVKLLHKMIQRDMSPDAISCNIVIDMLRKDEKYQECLDLL 214 Query: 191 PTFLPEHKQ 217 P FL + ++ Sbjct: 215 PRFLVQERR 223