BLASTX nr result
ID: Coptis24_contig00036207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036207 (221 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] 55 5e-06 >emb|CAN67605.1| hypothetical protein VITISV_030993 [Vitis vinifera] Length = 1290 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/63 (42%), Positives = 40/63 (63%), Gaps = 3/63 (4%) Frame = -1 Query: 185 STMGNWSELPEDILDQCLTKILSVESFVCSGSVCKSWRSVASKKKI---SSFAPWLILPK 15 + M +WS++P+D L K+ SVE +V G VCKSW S+ K+ SS +PWL+L + Sbjct: 917 TVMADWSKMPDDPLKLIAEKLHSVEDYVRFGGVCKSWYSIFEDKECCCPSSKSPWLMLAE 976 Query: 14 REN 6 +EN Sbjct: 977 KEN 979