BLASTX nr result
ID: Coptis24_contig00036193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036193 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] 118 4e-25 gb|ABV58319.1| metallothionein class I type 3 [Avicennia marina]... 103 1e-20 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 103 2e-20 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 102 2e-20 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 101 7e-20 >gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] Length = 63 Score = 118 bits (296), Expect = 4e-25 Identities = 49/63 (77%), Positives = 55/63 (87%) Frame = +2 Query: 53 MSDRCGNCDCADTTQCTKKGYAADIIETEKSYTAVMEVPAAAEHDGKCKCGSSCACTDCT 232 MSD+CG+CDCAD +QC K GY ADIIETEKSY VM+ PAAAE+DGKCKCGSSC+CTDCT Sbjct: 1 MSDKCGSCDCADKSQCGKNGYTADIIETEKSYAMVMDAPAAAENDGKCKCGSSCSCTDCT 60 Query: 233 CSH 241 C H Sbjct: 61 CGH 63 >gb|ABV58319.1| metallothionein class I type 3 [Avicennia marina] gi|157497147|gb|ABV58320.1| metallothionein class I type 3 [Avicennia marina] Length = 61 Score = 103 bits (257), Expect = 1e-20 Identities = 48/61 (78%), Positives = 51/61 (83%), Gaps = 2/61 (3%) Frame = +2 Query: 65 CGNCDCADTTQCTKKGYAADIIETEKSY-TAVMEVPA-AAEHDGKCKCGSSCACTDCTCS 238 CGNCDCAD +QC KKGYAA+IIETEKSY A M V A AAEHDGKCKCG SCACT+CTC Sbjct: 1 CGNCDCADKSQCMKKGYAAEIIETEKSYMEAAMLVDAPAAEHDGKCKCGPSCACTNCTCG 60 Query: 239 H 241 H Sbjct: 61 H 61 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 103 bits (256), Expect = 2e-20 Identities = 49/66 (74%), Positives = 53/66 (80%), Gaps = 3/66 (4%) Frame = +2 Query: 53 MSDRCGNCDCADTTQCTKKG--YAADIIETEKSY-TAVMEVPAAAEHDGKCKCGSSCACT 223 MSD CGNCDCAD TQC KKG Y ADIIETEKS T VM+ PAA E+DGKCKCG SC+CT Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAA-ENDGKCKCGPSCSCT 59 Query: 224 DCTCSH 241 +CTC H Sbjct: 60 NCTCGH 65 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 102 bits (255), Expect = 2e-20 Identities = 46/67 (68%), Positives = 51/67 (76%), Gaps = 4/67 (5%) Frame = +2 Query: 53 MSDRCGNCDCADTTQCTKKG--YAADIIETEKSY--TAVMEVPAAAEHDGKCKCGSSCAC 220 MS CGNCDCAD +QC KKG Y ADI+ETEKS+ T VM+VPA AE+DGKCKCG SC C Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCKCGPSCTC 60 Query: 221 TDCTCSH 241 DC C H Sbjct: 61 VDCGCGH 67 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 101 bits (251), Expect = 7e-20 Identities = 46/67 (68%), Positives = 52/67 (77%), Gaps = 4/67 (5%) Frame = +2 Query: 53 MSDRCGNCDCADTTQCTKKG--YAADIIETEKSY--TAVMEVPAAAEHDGKCKCGSSCAC 220 MS CGNCDCAD +QC KKG Y ADI+ETEKS+ T +M+VPAA EHDGKCKCG+SC C Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAA-EHDGKCKCGASCTC 59 Query: 221 TDCTCSH 241 CTC H Sbjct: 60 VTCTCGH 66