BLASTX nr result
ID: Coptis24_contig00036036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00036036 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera] 81 1e-13 ref|XP_003567531.1| PREDICTED: pentatricopeptide repeat-containi... 80 1e-13 emb|CBI21510.3| unnamed protein product [Vitis vinifera] 78 7e-13 ref|XP_002276001.1| PREDICTED: pentatricopeptide repeat-containi... 78 7e-13 ref|XP_004148468.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 >emb|CAN67343.1| hypothetical protein VITISV_038220 [Vitis vinifera] Length = 732 Score = 80.9 bits (198), Expect = 1e-13 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = -1 Query: 312 EAEKVRRRMDCSEVLKEPGNSWIEVNKAVHVFIAKDKSHNQAELIYSVLDKLTHLIKGVG 133 + +KVR RMD SEV+KEPG SWIEVN V+VFIA+ +H +A++I SVLD L IKG G Sbjct: 661 DVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVFIARXTTHREADMIGSVLDILIQHIKGAG 720 Query: 132 KVPDA 118 VPDA Sbjct: 721 YVPDA 725 >ref|XP_003567531.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Brachypodium distachyon] Length = 822 Score = 80.5 bits (197), Expect = 1e-13 Identities = 35/66 (53%), Positives = 52/66 (78%) Frame = -1 Query: 312 EAEKVRRRMDCSEVLKEPGNSWIEVNKAVHVFIAKDKSHNQAELIYSVLDKLTHLIKGVG 133 +A+K+R+ MDC+ V+KEPG SWIEV K VH FIA+ + H +A++IYS+LD+LT ++K G Sbjct: 739 DAQKLRQGMDCAGVVKEPGYSWIEVMKEVHTFIARGREHPEADVIYSLLDELTSILKNGG 798 Query: 132 KVPDAN 115 +PD + Sbjct: 799 YLPDTS 804 >emb|CBI21510.3| unnamed protein product [Vitis vinifera] Length = 746 Score = 78.2 bits (191), Expect = 7e-13 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -1 Query: 312 EAEKVRRRMDCSEVLKEPGNSWIEVNKAVHVFIAKDKSHNQAELIYSVLDKLTHLIKGVG 133 + +KVR RMD SEV+KEPG SWIEVN V+VFIA+D +H +A+ I SVLD L IKG G Sbjct: 674 DVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVFIARDTTHREAD-IGSVLDILIQHIKGAG 732 Query: 132 KVPDA 118 VPDA Sbjct: 733 YVPDA 737 >ref|XP_002276001.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Vitis vinifera] Length = 825 Score = 78.2 bits (191), Expect = 7e-13 Identities = 41/65 (63%), Positives = 49/65 (75%) Frame = -1 Query: 312 EAEKVRRRMDCSEVLKEPGNSWIEVNKAVHVFIAKDKSHNQAELIYSVLDKLTHLIKGVG 133 + +KVR RMD SEV+KEPG SWIEVN V+VFIA+D +H +A+ I SVLD L IKG G Sbjct: 753 DVKKVRDRMDSSEVVKEPGRSWIEVNNKVNVFIARDTTHREAD-IGSVLDILIQHIKGAG 811 Query: 132 KVPDA 118 VPDA Sbjct: 812 YVPDA 816 >ref|XP_004148468.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] gi|449515698|ref|XP_004164885.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] Length = 837 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/68 (50%), Positives = 50/68 (73%) Frame = -1 Query: 315 GEAEKVRRRMDCSEVLKEPGNSWIEVNKAVHVFIAKDKSHNQAELIYSVLDKLTHLIKGV 136 G+ +++R +MD + V+KEPG SWIEVN VH+F+++DK H++ +LIY LD+LT +K V Sbjct: 765 GDVKRLRLKMDVNGVVKEPGQSWIEVNGEVHIFVSRDKVHDETDLIYLALDELTTQMKDV 824 Query: 135 GKVPDANI 112 G V D I Sbjct: 825 GCVHDTTI 832