BLASTX nr result
ID: Coptis24_contig00035949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035949 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276764.2| PREDICTED: putative pentatricopeptide repeat... 80 2e-13 emb|CBI30291.3| unnamed protein product [Vitis vinifera] 80 2e-13 emb|CAN80331.1| hypothetical protein VITISV_018275 [Vitis vinifera] 80 2e-13 ref|XP_002266469.2| PREDICTED: putative pentatricopeptide repeat... 77 1e-12 emb|CBI31172.3| unnamed protein product [Vitis vinifera] 77 1e-12 >ref|XP_002276764.2| PREDICTED: putative pentatricopeptide repeat-containing protein At2g01510-like [Vitis vinifera] Length = 681 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 4 DCHSAIKLISKVVGRKIIVRDNSRFHHFGDGLCSCGDFW 120 DCHSAIK ISKV GRKIIVRDNSRFHHF DG CSCGD+W Sbjct: 643 DCHSAIKFISKVTGRKIIVRDNSRFHHFTDGSCSCGDYW 681 >emb|CBI30291.3| unnamed protein product [Vitis vinifera] Length = 616 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 4 DCHSAIKLISKVVGRKIIVRDNSRFHHFGDGLCSCGDFW 120 DCHSAIK ISKV GRKIIVRDNSRFHHF DG CSCGD+W Sbjct: 578 DCHSAIKFISKVTGRKIIVRDNSRFHHFTDGSCSCGDYW 616 >emb|CAN80331.1| hypothetical protein VITISV_018275 [Vitis vinifera] Length = 681 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/39 (87%), Positives = 35/39 (89%) Frame = +1 Query: 4 DCHSAIKLISKVVGRKIIVRDNSRFHHFGDGLCSCGDFW 120 DCHSAIK ISKV GRKIIVRDNSRFHHF DG CSCGD+W Sbjct: 643 DCHSAIKFISKVTGRKIIVRDNSRFHHFTDGSCSCGDYW 681 >ref|XP_002266469.2| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Vitis vinifera] Length = 709 Score = 77.0 bits (188), Expect = 1e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 4 DCHSAIKLISKVVGRKIIVRDNSRFHHFGDGLCSCGDFW 120 DCH+A K ISK+VGR+I+VRDNSRFHHF DG CSCGDFW Sbjct: 671 DCHTATKFISKIVGREIVVRDNSRFHHFKDGKCSCGDFW 709 >emb|CBI31172.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 77.0 bits (188), Expect = 1e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +1 Query: 4 DCHSAIKLISKVVGRKIIVRDNSRFHHFGDGLCSCGDFW 120 DCH+A K ISK+VGR+I+VRDNSRFHHF DG CSCGDFW Sbjct: 606 DCHTATKFISKIVGREIVVRDNSRFHHFKDGKCSCGDFW 644