BLASTX nr result
ID: Coptis24_contig00035914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035914 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera] 56 3e-06 >emb|CAN81016.1| hypothetical protein VITISV_025518 [Vitis vinifera] Length = 1461 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 3/71 (4%) Frame = +3 Query: 6 IGQGNYHEGLYYF---QSPSALAVIKPPSIDLWHWCLGHLSYRSLEILSQDVPFILCSNK 176 IG G H GLYY Q+P+ I S DLWH LGH S L++L++ P I +K Sbjct: 508 IGLGKQHNGLYYLAQDQNPALAYAIHKHS-DLWHQRLGHPSSGPLQVLAKVNPKIYFDSK 566 Query: 177 SVCQVCPQAKQ 209 VC +CP AKQ Sbjct: 567 HVCDICPLAKQ 577