BLASTX nr result
ID: Coptis24_contig00035755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035755 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_06580270.1| LOW QUALITY PROTEIN: conserved hypothetical p... 86 4e-30 ref|ZP_16642013.1| hypothetical protein HMPREF9619_02347 [Propio... 121 5e-26 ref|ZP_16583325.1| conserved domain protein [Propionibacterium a... 121 5e-26 ref|ZP_16586211.1| hypothetical protein HMPREF9589_00552 [Propio... 121 5e-26 ref|ZP_16539703.1| hypothetical protein HMPREF9582_02157 [Propio... 121 5e-26 >ref|ZP_06580270.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291343775|gb|EFE70731.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 134 Score = 85.9 bits (211), Expect(2) = 4e-30 Identities = 42/53 (79%), Positives = 44/53 (83%) Frame = -3 Query: 299 CPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGIASNRRSATLR 141 C GLH CYNG Y E R E ERIS+SRSQFGLGSATRPHEVG+ASNRRSA LR Sbjct: 36 CLGLHTCYNGRYNELRYREVERISKSRSQFGLGSATRPHEVGVASNRRSALLR 88 Score = 70.5 bits (171), Expect(2) = 4e-30 Identities = 37/46 (80%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = -2 Query: 141 VNTFPGLVHTARQVMKVGNTRSRWPNRCG-GAVEGGTGD*D*VETR 7 VNTFPG VHTAR V KVGNTRSRWPN G GAVEGGTGD D V TR Sbjct: 89 VNTFPGPVHTARHVTKVGNTRSRWPNPPGEGAVEGGTGDWDEVVTR 134 >ref|ZP_16642013.1| hypothetical protein HMPREF9619_02347 [Propionibacterium acnes HL082PA2] gi|314965109|gb|EFT09208.1| hypothetical protein HMPREF9619_02347 [Propionibacterium acnes HL082PA2] Length = 69 Score = 121 bits (304), Expect = 5e-26 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 1 RLPCFDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKARERIHRSVADLRLLAIPT 180 RLPC+DLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYK RERIHRSVADLRLLA PT Sbjct: 9 RLPCYDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKPRERIHRSVADLRLLATPT 68 Query: 181 S 183 S Sbjct: 69 S 69 >ref|ZP_16583325.1| conserved domain protein [Propionibacterium acnes HL046PA2] gi|313819502|gb|EFS57216.1| conserved domain protein [Propionibacterium acnes HL046PA2] Length = 314 Score = 121 bits (304), Expect = 5e-26 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 1 RLPCFDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKARERIHRSVADLRLLAIPT 180 RLPC+DLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYK RERIHRSVADLRLLA PT Sbjct: 254 RLPCYDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKPRERIHRSVADLRLLATPT 313 Query: 181 S 183 S Sbjct: 314 S 314 >ref|ZP_16586211.1| hypothetical protein HMPREF9589_00552 [Propionibacterium acnes HL059PA1] gi|313816616|gb|EFS54330.1| hypothetical protein HMPREF9589_00552 [Propionibacterium acnes HL059PA1] Length = 349 Score = 121 bits (304), Expect = 5e-26 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 1 RLPCFDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKARERIHRSVADLRLLAIPT 180 RLPC+DLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYK RERIHRSVADLRLLA PT Sbjct: 289 RLPCYDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKPRERIHRSVADLRLLATPT 348 Query: 181 S 183 S Sbjct: 349 S 349 >ref|ZP_16539703.1| hypothetical protein HMPREF9582_02157 [Propionibacterium acnes HL060PA1] gi|422465777|ref|ZP_16542364.1| hypothetical protein HMPREF9578_02279 [Propionibacterium acnes HL110PA4] gi|422516913|ref|ZP_16593020.1| hypothetical protein HMPREF9576_02368 [Propionibacterium acnes HL110PA2] gi|313801208|gb|EFS42468.1| hypothetical protein HMPREF9576_02368 [Propionibacterium acnes HL110PA2] gi|315092217|gb|EFT64193.1| hypothetical protein HMPREF9578_02279 [Propionibacterium acnes HL110PA4] gi|315094878|gb|EFT66854.1| hypothetical protein HMPREF9582_02157 [Propionibacterium acnes HL060PA1] Length = 92 Score = 121 bits (304), Expect = 5e-26 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = +1 Query: 1 RLPCFDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKARERIHRSVADLRLLAIPT 180 RLPC+DLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYK RERIHRSVADLRLLA PT Sbjct: 32 RLPCYDLVLITSPTFDGSPTTVRPPASGVTNFHDLTGGVYKPRERIHRSVADLRLLATPT 91 Query: 181 S 183 S Sbjct: 92 S 92