BLASTX nr result
ID: Coptis24_contig00035748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035748 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002872323.1| hypothetical protein ARALYDRAFT_910959 [Arab... 65 4e-09 ref|NP_085486.1| hypothetical protein ArthMp014 [Arabidopsis tha... 65 4e-09 >ref|XP_002872323.1| hypothetical protein ARALYDRAFT_910959 [Arabidopsis lyrata subsp. lyrata] gi|297813563|ref|XP_002874665.1| hypothetical protein ARALYDRAFT_911416 [Arabidopsis lyrata subsp. lyrata] gi|297318160|gb|EFH48582.1| hypothetical protein ARALYDRAFT_910959 [Arabidopsis lyrata subsp. lyrata] gi|297320502|gb|EFH50924.1| hypothetical protein ARALYDRAFT_911416 [Arabidopsis lyrata subsp. lyrata] Length = 118 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = +2 Query: 122 ISPYYSYFKVPLELLFPTTDRRSYFLKSYVFCSANSVP 235 I YYS KVPLELLFPTTDRR YFLKSYVFCSANSVP Sbjct: 25 IRTYYS--KVPLELLFPTTDRRFYFLKSYVFCSANSVP 60 >ref|NP_085486.1| hypothetical protein ArthMp014 [Arabidopsis thaliana] gi|44888111|sp|P93284.1|M150_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg00150; AltName: Full=ORF116 gi|1785686|emb|CAA69760.1| unnamed protein product [Arabidopsis thaliana] Length = 116 Score = 65.5 bits (158), Expect = 4e-09 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = +2 Query: 122 ISPYYSYFKVPLELLFPTTDRRSYFLKSYVFCSANSVP 235 I YYS KVPLELLFPTTDRR YFLKSYVFCSANSVP Sbjct: 25 IRTYYS--KVPLELLFPTTDRRFYFLKSYVFCSANSVP 60