BLASTX nr result
ID: Coptis24_contig00035745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035745 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 40 5e-06 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 40.4 bits (93), Expect(2) = 5e-06 Identities = 20/45 (44%), Positives = 28/45 (62%) Frame = -2 Query: 310 KTLSPLQGASLKGRCIGDNIWLASEIFHNMKRFEEKKEKQGWILL 176 K + PLQGA + R I DNI +A E+FH+ F+ K + GWI + Sbjct: 547 KIIHPLQGAFIPERLIQDNILIAHEVFHS---FKNKTGRGGWIAI 588 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -1 Query: 182 SVKLDMKKVYDQVEWTFVFKNSVRYSFIPL 93 ++KLDM+K YD++EW +++ + F P+ Sbjct: 587 AIKLDMEKAYDRLEWKYIYTTMDKMGFSPI 616