BLASTX nr result
ID: Coptis24_contig00035653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035653 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabid... 55 5e-06 ref|XP_003530321.1| PREDICTED: uncharacterized protein LOC100816... 55 8e-06 >emb|CAB39638.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana] gi|7267666|emb|CAB78094.1| RNA-directed DNA polymerase-like protein [Arabidopsis thaliana] Length = 1274 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/73 (36%), Positives = 39/73 (53%) Frame = +2 Query: 131 QDTLIWRCNPKGNYTVRTAYKLLSQNNWECSSSNFQNKTIQRVWKAKLSGRNQHFLWKVY 310 QD+L+W G YT +T Y L N++ S +F + + +WK S + +HFLWK Sbjct: 934 QDSLVWLPVKSGEYTTKTGYALAKLNSFPASQLDFNWQ--KNIWKIHTSPKVKHFLWKAM 991 Query: 311 IDGLPTGEVLNAR 349 LP GE L+ R Sbjct: 992 KGALPVGEALSRR 1004 >ref|XP_003530321.1| PREDICTED: uncharacterized protein LOC100816867 [Glycine max] Length = 704 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/73 (36%), Positives = 42/73 (57%) Frame = +2 Query: 131 QDTLIWRCNPKGNYTVRTAYKLLSQNNWECSSSNFQNKTIQRVWKAKLSGRNQHFLWKVY 310 QDT++W+ +P G Y+ ++AY+LL N S + Q +WK K+ R + F W+++ Sbjct: 396 QDTMLWKADPIGIYSTKSAYRLLLPIN----SPGQHRRNFQILWKLKIPPRAEMFSWRLF 451 Query: 311 IDGLPTGEVLNAR 349 D LPTG L R Sbjct: 452 RDRLPTGANLLRR 464