BLASTX nr result
ID: Coptis24_contig00034701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034701 (426 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulga... 57 1e-06 emb|CAN64017.1| hypothetical protein VITISV_031525 [Vitis vinifera] 57 2e-06 emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] 57 2e-06 emb|CAN60022.1| hypothetical protein VITISV_007671 [Vitis vinifera] 57 2e-06 emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera] 56 3e-06 >emb|CCA65974.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1379 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = +1 Query: 1 EKVASRLAGWKTKCLSKGGRCTLVKSTLSDIPYHFFSLFPIPR 129 EK+ +LA WK+K LS GGR TL+KS+L+ +P +F SLFPIP+ Sbjct: 766 EKLCEKLAMWKSKMLSIGGRLTLIKSSLASLPLYFMSLFPIPK 808 >emb|CAN64017.1| hypothetical protein VITISV_031525 [Vitis vinifera] Length = 1355 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = +1 Query: 1 EKVASRLAGWKTKCLSKGGRCTLVKSTLSDIPYHFFSLFPIPRE 132 E+ RLA WK + LSKGGR TLVKSTLS +P +F SLF IPR+ Sbjct: 1048 ERFQKRLALWKRQYLSKGGRLTLVKSTLSSLPIYFMSLFIIPRK 1091 >emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] Length = 501 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +1 Query: 1 EKVASRLAGWKTKCLSKGGRCTLVKSTLSDIPYHFFSLFPIPRE 132 E+ +LA WK + LSKGGR TL+KSTLS++P +F SLF IPR+ Sbjct: 67 ERFKRKLATWKKQYLSKGGRLTLIKSTLSNLPIYFMSLFVIPRK 110 >emb|CAN60022.1| hypothetical protein VITISV_007671 [Vitis vinifera] Length = 1610 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +1 Query: 1 EKVASRLAGWKTKCLSKGGRCTLVKSTLSDIPYHFFSLFPIPRE 132 E+ +LA WK + LSKGGR TL+KSTLS++P +F SLF IPR+ Sbjct: 1437 ERFKRKLATWKKQYLSKGGRLTLIKSTLSNLPIYFMSLFVIPRK 1480 >emb|CAN74183.1| hypothetical protein VITISV_034261 [Vitis vinifera] Length = 1201 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = +1 Query: 1 EKVASRLAGWKTKCLSKGGRCTLVKSTLSDIPYHFFSLFPIPRE 132 E+ +LA WK + LSKGGR TL+KSTLS++P +F SLF IPR+ Sbjct: 759 ERFKRKLAMWKKQYLSKGGRLTLIKSTLSNLPIYFMSLFVIPRK 802