BLASTX nr result
ID: Coptis24_contig00034271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034271 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635088.1| PREDICTED: uncharacterized protein LOC100853... 75 4e-12 emb|CBI38356.3| unnamed protein product [Vitis vinifera] 75 4e-12 emb|CAN83308.1| hypothetical protein VITISV_023019 [Vitis vinifera] 75 4e-12 ref|XP_003637259.1| hypothetical protein MTR_079s1010 [Medicago ... 72 4e-11 ref|XP_002522392.1| electron transporter, putative [Ricinus comm... 72 4e-11 >ref|XP_003635088.1| PREDICTED: uncharacterized protein LOC100853414 [Vitis vinifera] Length = 595 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/52 (69%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 371 CPAGVLEMIQQSLPETLRKTLRPFHE-KSRKCFEWLPHNFAFRYLISNELVR 219 CPAGV+EMIQQSLPE+LRK+++ KSRK EW+PHNF+FRYLIS ELV+ Sbjct: 544 CPAGVMEMIQQSLPESLRKSVKKCPAGKSRKNIEWIPHNFSFRYLISKELVK 595 >emb|CBI38356.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/52 (69%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 371 CPAGVLEMIQQSLPETLRKTLRPFHE-KSRKCFEWLPHNFAFRYLISNELVR 219 CPAGV+EMIQQSLPE+LRK+++ KSRK EW+PHNF+FRYLIS ELV+ Sbjct: 465 CPAGVMEMIQQSLPESLRKSVKKCPAGKSRKNIEWIPHNFSFRYLISKELVK 516 >emb|CAN83308.1| hypothetical protein VITISV_023019 [Vitis vinifera] Length = 719 Score = 75.5 bits (184), Expect = 4e-12 Identities = 36/52 (69%), Positives = 44/52 (84%), Gaps = 1/52 (1%) Frame = -3 Query: 371 CPAGVLEMIQQSLPETLRKTLRPFHE-KSRKCFEWLPHNFAFRYLISNELVR 219 CPAGV+EMIQQSLPE+LRK+++ KSRK EW+PHNF+FRYLIS ELV+ Sbjct: 668 CPAGVMEMIQQSLPESLRKSVKKCPAGKSRKNIEWIPHNFSFRYLISKELVK 719 >ref|XP_003637259.1| hypothetical protein MTR_079s1010 [Medicago truncatula] gi|355503194|gb|AES84397.1| hypothetical protein MTR_079s1010 [Medicago truncatula] Length = 626 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -3 Query: 365 AGVLEMIQQSLPETLRKTLRPFHEKSRKCFEWLPHNFAFRYLISNELVR 219 AG++EMIQQSLPE+LRK+++ H KS K EW+PHNF FRYLI ELV+ Sbjct: 578 AGLIEMIQQSLPESLRKSVKKCHAKSGKSIEWIPHNFTFRYLIPKELVK 626 >ref|XP_002522392.1| electron transporter, putative [Ricinus communis] gi|223538470|gb|EEF40076.1| electron transporter, putative [Ricinus communis] Length = 618 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -3 Query: 371 CPAGVLEMIQQSLPETLRKTLRPFH-EKSRKCFEWLPHNFAFRYLISNELVR 219 C AG++EMIQQ+LPE+LRK+++ KSRK EW+PHNF FRYLIS ELVR Sbjct: 567 CQAGLIEMIQQTLPESLRKSIKKCQLGKSRKIIEWIPHNFTFRYLISKELVR 618