BLASTX nr result
ID: Coptis24_contig00033982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033982 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_568996.1| Ras-related small GTP-binding family protein [A... 76 3e-12 dbj|BAA97293.1| unnamed protein product [Arabidopsis thaliana] 76 3e-12 gb|ACS66798.2| unknown [Dimocarpus longan] 76 3e-12 ref|XP_002279569.1| PREDICTED: uncharacterized GTP-binding prote... 76 3e-12 ref|XP_002533618.1| GTP-binding protein yptv3, putative [Ricinus... 75 6e-12 >ref|NP_568996.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana] gi|29839609|sp|Q9C5J9.1|Y5483_ARATH RecName: Full=Uncharacterized GTP-binding protein At5g64813 gi|13430582|gb|AAK25913.1|AF360203_1 unknown protein [Arabidopsis thaliana] gi|14532852|gb|AAK64108.1| unknown protein [Arabidopsis thaliana] gi|332010571|gb|AED97954.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana] Length = 342 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = -3 Query: 189 YDKEAVMKFFHMLIRRRYFSDEMHSSNPWSNTPAPKPVHGSGEILSDDDHHFYKTPSFIG 10 YDKEA+ KFF MLIRRRYFSDE+ +++PWS +P P + ++ DD FYK SF G Sbjct: 219 YDKEALNKFFRMLIRRRYFSDELPAASPWSISPVPTSSSQRLDEITSDDDQFYKRTSFHG 278 Query: 9 DPY 1 DPY Sbjct: 279 DPY 281 >dbj|BAA97293.1| unnamed protein product [Arabidopsis thaliana] Length = 651 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = -3 Query: 189 YDKEAVMKFFHMLIRRRYFSDEMHSSNPWSNTPAPKPVHGSGEILSDDDHHFYKTPSFIG 10 YDKEA+ KFF MLIRRRYFSDE+ +++PWS +P P + ++ DD FYK SF G Sbjct: 338 YDKEALNKFFRMLIRRRYFSDELPAASPWSISPVPTSSSQRLDEITSDDDQFYKRTSFHG 397 Query: 9 DPY 1 DPY Sbjct: 398 DPY 400 >gb|ACS66798.2| unknown [Dimocarpus longan] Length = 338 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/63 (58%), Positives = 43/63 (68%) Frame = -3 Query: 189 YDKEAVMKFFHMLIRRRYFSDEMHSSNPWSNTPAPKPVHGSGEILSDDDHHFYKTPSFIG 10 YDKEAV+KFF MLIRRRYFSDE+ NPWS +PA KP + D+ FYK+ S G Sbjct: 218 YDKEAVIKFFRMLIRRRYFSDELPVPNPWSISPAQKPSSQRLDENFSDEDSFYKSTSLSG 277 Query: 9 DPY 1 DPY Sbjct: 278 DPY 280 >ref|XP_002279569.1| PREDICTED: uncharacterized GTP-binding protein At5g64813 [Vitis vinifera] gi|147843269|emb|CAN80534.1| hypothetical protein VITISV_035973 [Vitis vinifera] gi|296082516|emb|CBI21521.3| unnamed protein product [Vitis vinifera] Length = 336 Score = 76.3 bits (186), Expect = 3e-12 Identities = 36/62 (58%), Positives = 46/62 (74%) Frame = -3 Query: 186 DKEAVMKFFHMLIRRRYFSDEMHSSNPWSNTPAPKPVHGSGEILSDDDHHFYKTPSFIGD 7 DKEAVMKFF +LIRRRYFSDE+ + +PWS +P P+ +G+ LS +D+ FYK S GD Sbjct: 219 DKEAVMKFFRLLIRRRYFSDELPAPSPWSISPVQGPIQRAGDNLS-EDNQFYKNTSLGGD 277 Query: 6 PY 1 PY Sbjct: 278 PY 279 >ref|XP_002533618.1| GTP-binding protein yptv3, putative [Ricinus communis] gi|223526492|gb|EEF28762.1| GTP-binding protein yptv3, putative [Ricinus communis] Length = 336 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = -3 Query: 189 YDKEAVMKFFHMLIRRRYFSDEMHSSNPWSNTPAPKPVHGSGEILSDDDHHFYKTPSFIG 10 YDKEA++KFF MLIRRRYFSDE+ + +PW+ +PA + V E SDDD FYK+ G Sbjct: 217 YDKEALLKFFRMLIRRRYFSDELTAPSPWTVSPAQRSVQRLDENSSDDD-QFYKSKRLTG 275 Query: 9 DPY 1 DPY Sbjct: 276 DPY 278