BLASTX nr result
ID: Coptis24_contig00033847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033847 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003624942.1| Pentatricopeptide repeat-containing protein ... 127 7e-28 gb|ABN08546.1| Tetratricopeptide-like helical [Medicago truncatula] 127 7e-28 gb|AFN53666.1| hypothetical protein [Linum usitatissimum] 124 6e-27 emb|CBI15196.3| unnamed protein product [Vitis vinifera] 124 6e-27 ref|XP_002281803.1| PREDICTED: pentatricopeptide repeat-containi... 124 6e-27 >ref|XP_003624942.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499957|gb|AES81160.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1092 Score = 127 bits (320), Expect = 7e-28 Identities = 54/91 (59%), Positives = 72/91 (79%) Frame = +1 Query: 1 VTMIAVLCACSHAGLVDEGRRCFDTMHQKFGIIPKLEHYGCIVDLLGRAGLLNEAYTFIE 180 +T +++L ACSH+GLVDEG++CFD M +++GI P L+HYGC+VDLLGRAG L +AY + Sbjct: 528 ITFVSLLSACSHSGLVDEGQKCFDIMQKEYGIKPSLKHYGCMVDLLGRAGYLEKAYELVR 587 Query: 181 SMPLVPHTGVWGALLNACKIYGNVELAECAS 273 +MP+ P +WGALL+ACKIYGN EL AS Sbjct: 588 NMPIQPDASIWGALLSACKIYGNAELGTLAS 618 >gb|ABN08546.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 1083 Score = 127 bits (320), Expect = 7e-28 Identities = 54/91 (59%), Positives = 72/91 (79%) Frame = +1 Query: 1 VTMIAVLCACSHAGLVDEGRRCFDTMHQKFGIIPKLEHYGCIVDLLGRAGLLNEAYTFIE 180 +T +++L ACSH+GLVDEG++CFD M +++GI P L+HYGC+VDLLGRAG L +AY + Sbjct: 528 ITFVSLLSACSHSGLVDEGQKCFDIMQKEYGIKPSLKHYGCMVDLLGRAGYLEKAYELVR 587 Query: 181 SMPLVPHTGVWGALLNACKIYGNVELAECAS 273 +MP+ P +WGALL+ACKIYGN EL AS Sbjct: 588 NMPIQPDASIWGALLSACKIYGNAELGTLAS 618 >gb|AFN53666.1| hypothetical protein [Linum usitatissimum] Length = 850 Score = 124 bits (312), Expect = 6e-27 Identities = 57/90 (63%), Positives = 69/90 (76%) Frame = +1 Query: 1 VTMIAVLCACSHAGLVDEGRRCFDTMHQKFGIIPKLEHYGCIVDLLGRAGLLNEAYTFIE 180 VT +LCACSH+GLVDEG+R FD M + +G++PK +HY C+VD+LGRAG L EA FIE Sbjct: 579 VTFTNLLCACSHSGLVDEGKRLFDEMERVYGVVPKTKHYSCMVDVLGRAGHLEEALKFIE 638 Query: 181 SMPLVPHTGVWGALLNACKIYGNVELAECA 270 MPL P VWGALL AC I+GN+ELAE A Sbjct: 639 GMPLAPSASVWGALLGACCIHGNLELAEKA 668 >emb|CBI15196.3| unnamed protein product [Vitis vinifera] Length = 467 Score = 124 bits (312), Expect = 6e-27 Identities = 54/87 (62%), Positives = 70/87 (80%) Frame = +1 Query: 1 VTMIAVLCACSHAGLVDEGRRCFDTMHQKFGIIPKLEHYGCIVDLLGRAGLLNEAYTFIE 180 +T I VLCACSHAG VD+GR F+ M++K+GI+P++EHYGC+VDLL RAG L+EA+ IE Sbjct: 274 ITFIGVLCACSHAGFVDQGRHFFECMNKKWGIVPRIEHYGCMVDLLSRAGFLDEAHRLIE 333 Query: 181 SMPLVPHTGVWGALLNACKIYGNVELA 261 SMP+ P+ VWGALL C+I+ N ELA Sbjct: 334 SMPMKPNDAVWGALLGGCRIHKNAELA 360 >ref|XP_002281803.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 553 Score = 124 bits (312), Expect = 6e-27 Identities = 54/87 (62%), Positives = 70/87 (80%) Frame = +1 Query: 1 VTMIAVLCACSHAGLVDEGRRCFDTMHQKFGIIPKLEHYGCIVDLLGRAGLLNEAYTFIE 180 +T I VLCACSHAG VD+GR F+ M++K+GI+P++EHYGC+VDLL RAG L+EA+ IE Sbjct: 360 ITFIGVLCACSHAGFVDQGRHFFECMNKKWGIVPRIEHYGCMVDLLSRAGFLDEAHRLIE 419 Query: 181 SMPLVPHTGVWGALLNACKIYGNVELA 261 SMP+ P+ VWGALL C+I+ N ELA Sbjct: 420 SMPMKPNDAVWGALLGGCRIHKNAELA 446