BLASTX nr result
ID: Coptis24_contig00033771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033771 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ89709.1| putative zinc finger protein [Hyacinthus orientalis] 80 2e-13 ref|XP_002283925.1| PREDICTED: cellular nucleic acid-binding pro... 73 3e-11 ref|XP_002463628.1| hypothetical protein SORBIDRAFT_01g003240 [S... 71 1e-10 gb|AFW67150.1| hypothetical protein ZEAMMB73_637389 [Zea mays] 69 4e-10 gb|ACN27672.1| unknown [Zea mays] gi|413932600|gb|AFW67151.1| hy... 69 4e-10 >gb|AAQ89709.1| putative zinc finger protein [Hyacinthus orientalis] Length = 244 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 271 PFRDILCCSYGHPRHISRDCVGIAICHNCGRRGHQAYECRSGRMLDRGL 125 PFRDI+C P HISRDCVGI IC+ CG RGH AYEC SGR+LDRG+ Sbjct: 192 PFRDIICRVCNQPGHISRDCVGIVICNTCGGRGHMAYECPSGRLLDRGM 240 >ref|XP_002283925.1| PREDICTED: cellular nucleic acid-binding protein [Vitis vinifera] gi|296086261|emb|CBI31702.3| unnamed protein product [Vitis vinifera] Length = 238 Score = 72.8 bits (177), Expect = 3e-11 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = -1 Query: 271 PFRDILCCSYGHPRHISRDCVGIAICHNCGRRGHQAYECRSGRMLD 134 PFRDI C + G P HISRDCV I IC+NCG RGHQ++EC S RM D Sbjct: 187 PFRDITCHNCGQPGHISRDCVSIVICNNCGGRGHQSFECPSVRMFD 232 >ref|XP_002463628.1| hypothetical protein SORBIDRAFT_01g003240 [Sorghum bicolor] gi|241917482|gb|EER90626.1| hypothetical protein SORBIDRAFT_01g003240 [Sorghum bicolor] Length = 258 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = -1 Query: 271 PFRDILCCSYGHPRHISRDCVGIAICHNCGRRGHQAYECRSGRMLDRGL 125 PFRDILC G P HISR+C+ IC CG RGH +YEC S R+ DRGL Sbjct: 207 PFRDILCRICGQPGHISRNCIATIICDTCGGRGHMSYECPSARIFDRGL 255 >gb|AFW67150.1| hypothetical protein ZEAMMB73_637389 [Zea mays] Length = 218 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -1 Query: 271 PFRDILCCSYGHPRHISRDCVGIAICHNCGRRGHQAYECRSGRMLDRG 128 PFRDILC G P HISR+C+ IC CG RGH +YEC S R+ DRG Sbjct: 167 PFRDILCRICGQPGHISRNCMATVICDTCGGRGHMSYECPSARIFDRG 214 >gb|ACN27672.1| unknown [Zea mays] gi|413932600|gb|AFW67151.1| hypothetical protein ZEAMMB73_637389 [Zea mays] Length = 256 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/48 (60%), Positives = 33/48 (68%) Frame = -1 Query: 271 PFRDILCCSYGHPRHISRDCVGIAICHNCGRRGHQAYECRSGRMLDRG 128 PFRDILC G P HISR+C+ IC CG RGH +YEC S R+ DRG Sbjct: 205 PFRDILCRICGQPGHISRNCMATVICDTCGGRGHMSYECPSARIFDRG 252