BLASTX nr result
ID: Coptis24_contig00033739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033739 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAB60760.1| F19K23.6 gene product [Arabidopsis thaliana] 64 2e-08 ref|NP_176402.2| Mitochondrial transcription termination factor ... 64 2e-08 ref|XP_002888050.1| hypothetical protein ARALYDRAFT_893294 [Arab... 62 4e-08 ref|XP_002888054.1| hypothetical protein ARALYDRAFT_893298 [Arab... 60 2e-07 ref|XP_002276370.1| PREDICTED: uncharacterized protein LOC100245... 60 2e-07 >gb|AAB60760.1| F19K23.6 gene product [Arabidopsis thaliana] Length = 827 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = +1 Query: 4 VLSKENVQSRVEFFTVKQNFELSDIAKNPVILALSLEKRIIPRCNVLEVLYSNGLIG 174 +LS E V+ ++EF K N+ L D+ NP +L +LEKR +PRCNV+E L S L+G Sbjct: 741 ILSAETVKKKIEFVVKKMNWPLKDVVSNPTVLGYNLEKRTVPRCNVIEALMSKRLLG 797 >ref|NP_176402.2| Mitochondrial transcription termination factor family protein [Arabidopsis thaliana] gi|26450724|dbj|BAC42471.1| unknown protein [Arabidopsis thaliana] gi|28951041|gb|AAO63444.1| At1g62110 [Arabidopsis thaliana] gi|332195803|gb|AEE33924.1| Mitochondrial transcription termination factor family protein [Arabidopsis thaliana] Length = 462 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = +1 Query: 4 VLSKENVQSRVEFFTVKQNFELSDIAKNPVILALSLEKRIIPRCNVLEVLYSNGLIG 174 +LS E V+ ++EF K N+ L D+ NP +L +LEKR +PRCNV+E L S L+G Sbjct: 358 ILSAETVKKKIEFVVKKMNWPLKDVVSNPTVLGYNLEKRTVPRCNVIEALMSKRLLG 414 >ref|XP_002888050.1| hypothetical protein ARALYDRAFT_893294 [Arabidopsis lyrata subsp. lyrata] gi|297333891|gb|EFH64309.1| hypothetical protein ARALYDRAFT_893294 [Arabidopsis lyrata subsp. lyrata] Length = 220 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = +1 Query: 1 FVLSKENVQSRVEFFTVKQNFELSDIAKNPVILALSLEKRIIPRCNVLEVLYSNGLIGRV 180 F LS E V+ + EF K + L + NP L SL+KRI+PRCNV++ L S GLIGR+ Sbjct: 151 FGLSAETVEKKTEFLVKKIIWPLKSVVSNPAGLGYSLQKRIVPRCNVIKALMSKGLIGRL 210 Query: 181 N 183 N Sbjct: 211 N 211 >ref|XP_002888054.1| hypothetical protein ARALYDRAFT_893298 [Arabidopsis lyrata subsp. lyrata] gi|297333895|gb|EFH64313.1| hypothetical protein ARALYDRAFT_893298 [Arabidopsis lyrata subsp. lyrata] Length = 768 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/56 (46%), Positives = 37/56 (66%) Frame = +1 Query: 7 LSKENVQSRVEFFTVKQNFELSDIAKNPVILALSLEKRIIPRCNVLEVLYSNGLIG 174 LS E V+ + EF K N+ L + NP +L ++EKRI+PRCNV++ L S GL+G Sbjct: 309 LSAETVKKKTEFLVKKMNWPLKALVLNPAVLGYNMEKRIVPRCNVIKALMSKGLLG 364 >ref|XP_002276370.1| PREDICTED: uncharacterized protein LOC100245862 [Vitis vinifera] Length = 403 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/58 (50%), Positives = 44/58 (75%) Frame = +1 Query: 4 VLSKENVQSRVEFFTVKQNFELSDIAKNPVILALSLEKRIIPRCNVLEVLYSNGLIGR 177 VLS++ + + ++F+ K +E S IA+ PV+L+LSLEKRIIPR +V++VL S GLI + Sbjct: 285 VLSEDKLMATMDFYVNKMGWESSFIARRPVLLSLSLEKRIIPRYSVVQVLLSKGLINK 342