BLASTX nr result
ID: Coptis24_contig00033709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033709 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAZ40333.1| hypothetical protein [Raphanus sativus] 63 2e-08 >emb|CAZ40333.1| hypothetical protein [Raphanus sativus] Length = 785 Score = 63.2 bits (152), Expect = 2e-08 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 6/72 (8%) Frame = +1 Query: 196 IQSAAQKHLVDSNSKYKVATDKHRQVVNFEAGDF------KDRAPAGDYNRLGLHKIGPF 357 + AQ HL + +KYK+A D R + FE GD K+R P DYN+L K+GP Sbjct: 669 VHKLAQSHLESATTKYKLAADTKRCELIFEPGDLVWVYLTKERLPLRDYNKLKSKKLGPV 728 Query: 358 EVIRKINPNAYK 393 EV+ +INPN Y+ Sbjct: 729 EVVERINPNVYR 740