BLASTX nr result
ID: Coptis24_contig00033415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033415 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268394.1| PREDICTED: cyclin-D1-1 [Vitis vinifera] gi|2... 59 3e-07 >ref|XP_002268394.1| PREDICTED: cyclin-D1-1 [Vitis vinifera] gi|296086502|emb|CBI32091.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/55 (56%), Positives = 38/55 (69%) Frame = +3 Query: 177 DLLCCEEAEILRDDLPDYYSPNTEFPEDIEESIAGLIEDEGEYMPRFDYQEMFQS 341 DLLC E++ IL DLP+ S + E P DIEESIAG IEDE ++P FDY F+S Sbjct: 11 DLLCGEDSSILSGDLPEC-SSDLESPTDIEESIAGFIEDERNFVPGFDYLARFRS 64