BLASTX nr result
ID: Coptis24_contig00033254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033254 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus ... 54 7e-08 ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 >ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223527546|gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 389 Score = 54.3 bits (129), Expect(2) = 7e-08 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 5/120 (4%) Frame = -3 Query: 546 LSIVGFCNGLSCLSDNNTYMALSNPATAENILVSFGLVEQSP---ADYTRISVLGFSHDP 376 + I+G CNGL C+ + +AL NP+ + +V + VE R+SV GF +D Sbjct: 89 VKILGSCNGLLCICNIVDDIALWNPSIRAHRVVPYLPVELKRYFGMCSCRVSVFGFGYDL 148 Query: 375 LIDKYKAVRIDMYGS*RADADFSKAYAQYTLGINAWRRIPS-PYRLCYTG-GVAHLNGAL 202 D YK VRI +G + F ++L N+WRRI PY + Y G + NGAL Sbjct: 149 SNDDYKLVRIAQFGGVDRKS-FESEVKVFSLRKNSWRRIADMPYCVLYPGENGIYANGAL 207 Score = 27.7 bits (60), Expect(2) = 7e-08 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -2 Query: 139 SFISFDVGSEEFRRLPWNIWLGSEVNGRNLGVLQGCLSM 23 + ++ D+G E++ +P ++ N +GVLQGCLS+ Sbjct: 222 TIVALDLGVEDYHVVPKPEFVDMNCN-MGVGVLQGCLSL 259 >ref|XP_002297705.1| predicted protein [Populus trichocarpa] gi|222844963|gb|EEE82510.1| predicted protein [Populus trichocarpa] Length = 408 Score = 56.6 bits (135), Expect = 3e-06 Identities = 39/107 (36%), Positives = 58/107 (54%), Gaps = 7/107 (6%) Frame = -3 Query: 540 IVGFCNGLSCLSDNNTYMALSNPATAENILVSFGLVE-QSPADYTRISVL----GFSHDP 376 ++G CNGL L +++ +AL NP+T E ++ +E + D +++S L GF HDP Sbjct: 93 VMGSCNGLLALLNSDFSIALYNPSTREKKMIPVSPLELPNDLDDSKVSSLFNFYGFGHDP 152 Query: 375 LIDKYKAVR-IDMYGS*RADADFSKAYAQYTLGINAWRRIPS-PYRL 241 + + YK VR I YG D F Y+L N+W+RI PY L Sbjct: 153 INEDYKVVRFIHFYGD-SPDGFFHCEVKVYSLKSNSWKRIDDYPYDL 198