BLASTX nr result
ID: Coptis24_contig00033048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033048 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619167.1| Chlorophyll a-b binding protein 3C-like prot... 88 6e-16 gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein ... 86 2e-15 gb|AAG52048.1|AC022455_2 chlorophyll A-B-binding protein 2 precu... 86 2e-15 ref|NP_174286.1| chlorophyll a-b binding protein 1 [Arabidopsis ... 86 2e-15 gb|AAL38341.1| chlorophyll a/b-binding protein [Arabidopsis thal... 86 2e-15 >ref|XP_003619167.1| Chlorophyll a-b binding protein 3C-like protein [Medicago truncatula] gi|355494182|gb|AES75385.1| Chlorophyll a-b binding protein 3C-like protein [Medicago truncatula] Length = 229 Score = 88.2 bits (217), Expect = 6e-16 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 297 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVLGK 175 FGFFVQAIVTGKGP+ENLADHLADPVNNNAWAFATNFVLGK Sbjct: 189 FGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVLGK 229 >gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem II [Ginkgo biloba] Length = 270 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 297 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVLGK 175 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFV GK Sbjct: 230 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 270 >gb|AAG52048.1|AC022455_2 chlorophyll A-B-binding protein 2 precursor, 5' partial; 1-750 [Arabidopsis thaliana] Length = 249 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 297 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVLGK 175 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFV GK Sbjct: 209 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 249 >ref|NP_174286.1| chlorophyll a-b binding protein 1 [Arabidopsis thaliana] gi|115783|sp|P04778.1|CB1C_ARATH RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; AltName: Full=Chlorophyll a-b protein 140; Short=CAB-140; AltName: Full=LHCII type I CAB-1; Flags: Precursor gi|9972353|gb|AAG10603.1|AC008030_3 Putative chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|16226883|gb|AAL16289.1|AF428359_1 At1g29930/F1N18_23 [Arabidopsis thaliana] gi|16376|emb|CAA27543.1| chlorophyll a/b binding protein (LHCP AB 140) [Arabidopsis thaliana] gi|15010744|gb|AAK74031.1| At1g29930/F1N18_23 [Arabidopsis thaliana] gi|15293003|gb|AAK93612.1| putative photosystem II type I chlorophyll a/b binding protein [Arabidopsis thaliana] gi|16648807|gb|AAL25594.1| At1g29930/F1N18_23 [Arabidopsis thaliana] gi|20258873|gb|AAM14108.1| putative chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|332193030|gb|AEE31151.1| chlorophyll a-b binding protein 1 [Arabidopsis thaliana] Length = 267 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 297 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVLGK 175 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFV GK Sbjct: 227 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267 >gb|AAL38341.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] gi|21387019|gb|AAM47913.1| chlorophyll a/b-binding protein [Arabidopsis thaliana] Length = 267 Score = 86.3 bits (212), Expect = 2e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 297 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVLGK 175 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFV GK Sbjct: 227 FGFFVQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK 267