BLASTX nr result
ID: Coptis24_contig00032956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032956 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-09 ref|XP_002531596.1| pentatricopeptide repeat-containing protein,... 63 3e-08 ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >ref|XP_004168984.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 461 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -2 Query: 170 NLFKRISSLGDQTVSVVPLLQQWVIEEERSVTEDELNNFIKYLKARKRFKHALEIS 3 NL++RIS +GD +SV PLL QWV+ E R V +DEL + IK L+ KRFKHALEIS Sbjct: 30 NLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHALEIS 84 >ref|XP_004146598.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 227 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = -2 Query: 170 NLFKRISSLGDQTVSVVPLLQQWVIEEERSVTEDELNNFIKYLKARKRFKHALEIS 3 NL++RIS +GD +SV PLL QWV+ E R V +DEL + IK L+ KRFKHALEIS Sbjct: 30 NLYRRISPVGDPNISVTPLLDQWVL-EGRLVQQDELRHIIKELRVYKRFKHALEIS 84 >ref|XP_002531596.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223528792|gb|EEF30799.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 300 Score = 62.8 bits (151), Expect = 3e-08 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -2 Query: 167 LFKRISSLGDQTVSVVPLLQQWVIEEERSVTEDELNNFIKYLKARKRFKHALEIS 3 L++RIS +GD VS+VP+L QW IEE +SV +D+L FIK L+ KR+ HALEIS Sbjct: 51 LYRRISPVGDPKVSIVPILDQW-IEEGKSVNKDQLQVFIKELRYCKRYTHALEIS 104 >ref|XP_004168986.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 191 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -2 Query: 170 NLFKRISSLGDQTVSVVPLLQQWVIEEERSVTEDELNNFIKYLKARKRFKHALEI 6 +L++RIS +GD +SV PLL QWV+ E V +DEL + IK L+ KRFKHALE+ Sbjct: 30 SLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHALEV 83 >ref|XP_004146650.1| PREDICTED: pentatricopeptide repeat-containing protein At2g20710, mitochondrial-like [Cucumis sativus] Length = 222 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -2 Query: 170 NLFKRISSLGDQTVSVVPLLQQWVIEEERSVTEDELNNFIKYLKARKRFKHALEI 6 +L++RIS +GD +SV PLL QWV+ E V +DEL + IK L+ KRFKHALE+ Sbjct: 30 SLYRRISPVGDPNISVTPLLDQWVL-ESGLVQQDELRHIIKELRVYKRFKHALEV 83