BLASTX nr result
ID: Coptis24_contig00032752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032752 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_05988151.1| hypothetical protein COK_0004 [Mannheimia hae... 56 3e-06 ref|ZP_16380655.1| unnamed protein product [Neisseria lactamica ... 43 4e-06 >ref|ZP_05988151.1| hypothetical protein COK_0004 [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261494299|ref|ZP_05990795.1| hypothetical protein COI_0097 [Mannheimia haemolytica serotype A2 str. OVINE] gi|261310041|gb|EEY11248.1| hypothetical protein COI_0097 [Mannheimia haemolytica serotype A2 str. OVINE] gi|261312773|gb|EEY13892.1| hypothetical protein COK_0004 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 47 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/46 (63%), Positives = 32/46 (69%) Frame = +2 Query: 95 DVSTRRVSPV*HVLVFGVCHGLVSLNDPLAITVLYPQECSHEALPK 232 DVST RVSP H VF VC GLV + PLA TVLYP+ C +ALPK Sbjct: 2 DVSTHRVSPEYHSSVFAVCIGLVIRDGPLAETVLYPRRCPLKALPK 47 >ref|ZP_16380655.1| unnamed protein product [Neisseria lactamica Y92-1009] gi|309378569|emb|CBX22841.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 49 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 19/24 (79%), Positives = 22/24 (91%) Frame = -3 Query: 121 GRHTAGANVRREKGNNPDRQLRSQ 50 GR TAGANVR ++GNNPDR+LRSQ Sbjct: 23 GRQTAGANVRCQEGNNPDRRLRSQ 46 Score = 32.3 bits (72), Expect(2) = 4e-06 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -1 Query: 186 MARGSLRLTKPWQTPNTRTCYTG 118 MARG L+LT PWQT NT + G Sbjct: 1 MARGLLQLTNPWQTQNTIKWFLG 23