BLASTX nr result
ID: Coptis24_contig00032600
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032600 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164425.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 84 2e-14 ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_003635646.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_003635637.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_003556972.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 >ref|XP_004164425.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cucumis sativus] Length = 849 Score = 83.6 bits (205), Expect = 2e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 299 RICGDCHSAMKFISVSSKREIVVRDTNRFHHIKDGLCSCNDYW 171 RICGDCHSA+K+IS+++ REI+VRD NRFHHIKDG CSCN+YW Sbjct: 807 RICGDCHSAIKYISMATGREIIVRDANRFHHIKDGRCSCNEYW 849 >ref|XP_004151259.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Cucumis sativus] Length = 849 Score = 83.6 bits (205), Expect = 2e-14 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 299 RICGDCHSAMKFISVSSKREIVVRDTNRFHHIKDGLCSCNDYW 171 RICGDCHSA+K+IS+++ REI+VRD NRFHHIKDG CSCN+YW Sbjct: 807 RICGDCHSAIKYISMATGREIIVRDANRFHHIKDGRCSCNEYW 849 >ref|XP_003635646.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like, partial [Vitis vinifera] Length = 809 Score = 83.6 bits (205), Expect = 2e-14 Identities = 32/43 (74%), Positives = 42/43 (97%) Frame = -2 Query: 299 RICGDCHSAMKFISVSSKREIVVRDTNRFHHIKDGLCSCNDYW 171 R+CGDCH+A+K+IS+++ REIVVRD+NRFHHIK+G+CSCNDYW Sbjct: 767 RVCGDCHTAIKYISMATGREIVVRDSNRFHHIKNGVCSCNDYW 809 >ref|XP_003635637.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like, partial [Vitis vinifera] Length = 629 Score = 83.6 bits (205), Expect = 2e-14 Identities = 32/43 (74%), Positives = 42/43 (97%) Frame = -2 Query: 299 RICGDCHSAMKFISVSSKREIVVRDTNRFHHIKDGLCSCNDYW 171 R+CGDCH+A+K+IS+++ REIVVRD+NRFHHIK+G+CSCNDYW Sbjct: 587 RVCGDCHTAIKYISMATGREIVVRDSNRFHHIKNGVCSCNDYW 629 >ref|XP_003556972.1| PREDICTED: pentatricopeptide repeat-containing protein At3g49170, chloroplastic-like [Glycine max] Length = 820 Score = 83.6 bits (205), Expect = 2e-14 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -2 Query: 299 RICGDCHSAMKFISVSSKREIVVRDTNRFHHIKDGLCSCNDYW 171 R+CGDCH+A+K+IS+ + REIVVRD NRFHHIKDG CSCNDYW Sbjct: 778 RVCGDCHTAIKYISIVTGREIVVRDANRFHHIKDGKCSCNDYW 820