BLASTX nr result
ID: Coptis24_contig00032355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032355 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 9/98 (9%) Frame = -2 Query: 268 SSFTAIVTPLKIAQKGKPSTLFTHPLTLSSS-----ISNTFNETPDL----NIIKCKCKS 116 SS + ++ + + K S+LF HP S +T + PD N +K CKS Sbjct: 9 SSSASAISSSRTTPRCKLSSLFEHPHRPISPGPISLTKDTVSNAPDRGQLENFLKSNCKS 68 Query: 115 GKITLHEAMGFFDSMILLNPFPPVSTFNLVLGALTRIK 2 G I EA F+ +I + P PP+S+FN +LGA+ +IK Sbjct: 69 GHIKRSEAFSVFNHLIDMQPTPPISSFNTLLGAVAKIK 106