BLASTX nr result
ID: Coptis24_contig00032296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032296 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539025.1| PREDICTED: putative pentatricopeptide repeat... 70 2e-10 ref|XP_003631603.1| PREDICTED: putative pentatricopeptide repeat... 64 2e-08 ref|XP_004159175.1| PREDICTED: putative pentatricopeptide repeat... 62 6e-08 ref|XP_004148310.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 62 6e-08 ref|XP_002306089.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_003539025.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Glycine max] Length = 681 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -2 Query: 416 KMRGGEVRKLAGCSWVYIEKTKNIFTSGDRSHSQYEAIYSMLTSLYLVCVKGK 258 KMRG E +KLAGCSW+Y+E ++FTSGDRSHS+ EA+YS LT C+ GK Sbjct: 614 KMRGHEAKKLAGCSWIYVENGIHVFTSGDRSHSKAEAVYSTLT-----CLNGK 661 >ref|XP_003631603.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Vitis vinifera] Length = 670 Score = 63.5 bits (153), Expect = 2e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -2 Query: 416 KMRGGEVRKLAGCSWVYIEKTKNIFTSGDRSHSQYEAIYSMLTSL 282 KMR E++K AGCSWVY+E +IFTSGD SHS EAIYS+L L Sbjct: 617 KMRENEIKKFAGCSWVYVENRVHIFTSGDSSHSSAEAIYSILLIL 661 >ref|XP_004159175.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Cucumis sativus] Length = 1096 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 416 KMRGGEVRKLAGCSWVYIEKTKNIFTSGDRSHSQYEAIYSMLTSL 282 KM+G EV+K AGCSWV++E ++F SGDR HS+ EAIYS L SL Sbjct: 1040 KMKGKEVKKNAGCSWVFVESKFHVFISGDRFHSKNEAIYSTLASL 1084 >ref|XP_004148310.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g18840-like [Cucumis sativus] Length = 1096 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -2 Query: 416 KMRGGEVRKLAGCSWVYIEKTKNIFTSGDRSHSQYEAIYSMLTSL 282 KM+G EV+K AGCSWV++E ++F SGDR HS+ EAIYS L SL Sbjct: 1040 KMKGKEVKKNAGCSWVFVESKFHVFISGDRFHSKNEAIYSTLASL 1084 >ref|XP_002306089.1| predicted protein [Populus trichocarpa] gi|222849053|gb|EEE86600.1| predicted protein [Populus trichocarpa] Length = 677 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/45 (57%), Positives = 35/45 (77%) Frame = -2 Query: 416 KMRGGEVRKLAGCSWVYIEKTKNIFTSGDRSHSQYEAIYSMLTSL 282 +MRG E +K AGCSWVY++ + FTSGDR+H++ E+IYSML L Sbjct: 621 EMRGKEAKKFAGCSWVYLDNEVHSFTSGDRTHTKAESIYSMLEFL 665