BLASTX nr result
ID: Coptis24_contig00032223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032223 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003619014.1| Cytochrome c oxidase subunit [Medicago trunc... 59 5e-07 >ref|XP_003619014.1| Cytochrome c oxidase subunit [Medicago truncatula] gi|355494029|gb|AES75232.1| Cytochrome c oxidase subunit [Medicago truncatula] Length = 276 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/38 (73%), Positives = 28/38 (73%) Frame = -2 Query: 116 PFFTTFRXXXXXXGVLHTTEAKWFMIESQRHYYHLVDP 3 PFFTT G LHTTEAKWFMIESQRH YHLVDP Sbjct: 46 PFFTTLGGGGGRGGGLHTTEAKWFMIESQRHSYHLVDP 83