BLASTX nr result
ID: Coptis24_contig00032098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032098 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316491.1| cationic amino acid transporter [Populus tri... 91 1e-16 ref|XP_002515785.1| cationic amino acid transporter, putative [R... 82 4e-14 ref|XP_002269556.1| PREDICTED: high affinity cationic amino acid... 80 2e-13 ref|XP_003637200.1| High affinity cationic amino acid transporte... 77 2e-12 ref|XP_003555221.1| PREDICTED: low affinity cationic amino acid ... 76 2e-12 >ref|XP_002316491.1| cationic amino acid transporter [Populus trichocarpa] gi|222865531|gb|EEF02662.1| cationic amino acid transporter [Populus trichocarpa] Length = 600 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/59 (71%), Positives = 51/59 (86%) Frame = +3 Query: 24 MEQTHGSSFSSIRAYGQALIQTPKRVLHRAGSVSTSYDEMSRIRARSGSNMQKTLRWFD 200 ME +HGSSFSS+ +Y QAL QTP R RAGSVSTSY+EMSR++ARSGS+MQ+TLRW+D Sbjct: 1 MESSHGSSFSSLNSYIQALAQTPARFARRAGSVSTSYEEMSRVKARSGSDMQRTLRWYD 59 >ref|XP_002515785.1| cationic amino acid transporter, putative [Ricinus communis] gi|223545113|gb|EEF46624.1| cationic amino acid transporter, putative [Ricinus communis] Length = 576 Score = 82.0 bits (201), Expect = 4e-14 Identities = 42/59 (71%), Positives = 48/59 (81%) Frame = +3 Query: 24 MEQTHGSSFSSIRAYGQALIQTPKRVLHRAGSVSTSYDEMSRIRARSGSNMQKTLRWFD 200 ME H SSFSS R+Y QAL QTP R+ RAGSVSTSY+EMSR++ARSGS MQK+LRW D Sbjct: 1 MEIGHVSSFSSFRSYLQALGQTPTRLACRAGSVSTSYEEMSRVKARSGSEMQKSLRWHD 59 >ref|XP_002269556.1| PREDICTED: high affinity cationic amino acid transporter 1 [Vitis vinifera] Length = 586 Score = 80.1 bits (196), Expect = 2e-13 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 1/57 (1%) Frame = +3 Query: 33 THGSS-FSSIRAYGQALIQTPKRVLHRAGSVSTSYDEMSRIRARSGSNMQKTLRWFD 200 THGSS FSS AY +AL QTP R+ RA SVSTS++EMSR+RARSGS+MQ+ LRWFD Sbjct: 3 THGSSSFSSFTAYARALAQTPSRLARRACSVSTSFEEMSRVRARSGSDMQRNLRWFD 59 >ref|XP_003637200.1| High affinity cationic amino acid transporter [Medicago truncatula] gi|355503135|gb|AES84338.1| High affinity cationic amino acid transporter [Medicago truncatula] Length = 623 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/56 (64%), Positives = 46/56 (82%) Frame = +3 Query: 33 THGSSFSSIRAYGQALIQTPKRVLHRAGSVSTSYDEMSRIRARSGSNMQKTLRWFD 200 +HGSSFSS+ Y QA+ +TP R R SVSTSY+EMSR+RARSG++M+K+LRWFD Sbjct: 3 SHGSSFSSLPNYLQAVAKTPSRFARRGFSVSTSYEEMSRVRARSGNSMRKSLRWFD 58 >ref|XP_003555221.1| PREDICTED: low affinity cationic amino acid transporter 2-like [Glycine max] Length = 587 Score = 76.3 bits (186), Expect = 2e-12 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = +3 Query: 42 SSFSSIRAYGQALIQTPKRVLHRAGSVSTSYDEMSRIRARSGSNMQKTLRWFD 200 SSFSS+RAY AL TP R+ RA SVSTSYDEMS++RARSG++M+KTLRWFD Sbjct: 9 SSFSSLRAYLSALSHTPTRLALRALSVSTSYDEMSQVRARSGTSMRKTLRWFD 61