BLASTX nr result
ID: Coptis24_contig00032019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032019 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281741.1| PREDICTED: BTB/POZ domain-containing protein... 65 8e-09 >ref|XP_002281741.1| PREDICTED: BTB/POZ domain-containing protein At5g60050 [Vitis vinifera] gi|297746172|emb|CBI16228.3| unnamed protein product [Vitis vinifera] Length = 499 Score = 64.7 bits (156), Expect = 8e-09 Identities = 39/92 (42%), Positives = 55/92 (59%) Frame = -2 Query: 276 MAAESILRSKQVSAMIKQGFIXXXXXXXXXXXXXXXXXXXPCFTQNNIKPTSSSTLYEMM 97 MAA++IL+S+QVS MIKQGFI P + P+ S TL+EMM Sbjct: 1 MAADNILKSRQVSTMIKQGFISDPTITFSPSRPLSRVSLSP--PPPSASPSKSPTLFEMM 58 Query: 96 SEEQQRESKQLEDKRRISQERVSKILDNAPFQ 1 SEEQ RES+ + RR Q++V+++L +APF+ Sbjct: 59 SEEQSRESRHSDVARRKLQDQVARVLADAPFR 90