BLASTX nr result
ID: Coptis24_contig00031408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031408 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28998.3| unnamed protein product [Vitis vinifera] 160 1e-37 ref|XP_002267326.1| PREDICTED: pentatricopeptide repeat-containi... 160 1e-37 ref|XP_004173450.1| PREDICTED: pentatricopeptide repeat-containi... 128 6e-28 ref|XP_004171410.1| PREDICTED: pentatricopeptide repeat-containi... 128 6e-28 ref|XP_004147136.1| PREDICTED: pentatricopeptide repeat-containi... 128 6e-28 >emb|CBI28998.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 160 bits (404), Expect = 1e-37 Identities = 75/110 (68%), Positives = 89/110 (80%) Frame = -2 Query: 509 SHLGLVELGCSFFDSISSVYKMVPSEENFGSLVDLFSRNGFLEEAKHVLEVMPFAPWPAV 330 SHLGLVE G FF S++ Y M PS +N+G LVDLFSRNGFLE+AKH++E MPF PWPA+ Sbjct: 599 SHLGLVEQGDIFFKSMNLDYGMDPSPDNYGCLVDLFSRNGFLEDAKHIIETMPFPPWPAI 658 Query: 329 WRSILNGCRIHGNRNLGEWASKHLLQLVPKNDAAYVLLSVKA*GKCDWSN 180 WRS+LNGCRIHGN+ LGEWA+K LLQLVP+NDAAYVLLS + WS+ Sbjct: 659 WRSLLNGCRIHGNKELGEWAAKKLLQLVPENDAAYVLLSKVYSEEGSWSD 708 >ref|XP_002267326.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] Length = 708 Score = 160 bits (404), Expect = 1e-37 Identities = 75/110 (68%), Positives = 89/110 (80%) Frame = -2 Query: 509 SHLGLVELGCSFFDSISSVYKMVPSEENFGSLVDLFSRNGFLEEAKHVLEVMPFAPWPAV 330 SHLGLVE G FF S++ Y M PS +N+G LVDLFSRNGFLE+AKH++E MPF PWPA+ Sbjct: 575 SHLGLVEQGDIFFKSMNLDYGMDPSPDNYGCLVDLFSRNGFLEDAKHIIETMPFPPWPAI 634 Query: 329 WRSILNGCRIHGNRNLGEWASKHLLQLVPKNDAAYVLLSVKA*GKCDWSN 180 WRS+LNGCRIHGN+ LGEWA+K LLQLVP+NDAAYVLLS + WS+ Sbjct: 635 WRSLLNGCRIHGNKELGEWAAKKLLQLVPENDAAYVLLSKVYSEEGSWSD 684 >ref|XP_004173450.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Cucumis sativus] Length = 453 Score = 128 bits (321), Expect = 6e-28 Identities = 56/98 (57%), Positives = 77/98 (78%) Frame = -2 Query: 506 HLGLVELGCSFFDSISSVYKMVPSEENFGSLVDLFSRNGFLEEAKHVLEVMPFAPWPAVW 327 H+GLVE G S F ++ S Y M PS +N+G LVD+ SRNGFL +A++++E MPF+PWPA+ Sbjct: 321 HMGLVEQGRSLFQTMKSDYNMTPSRDNYGCLVDMLSRNGFLYDARYIIESMPFSPWPAIL 380 Query: 326 RSILNGCRIHGNRNLGEWASKHLLQLVPKNDAAYVLLS 213 RS+L+GCRI+GNR LG+W ++ LL L P+N A +VLLS Sbjct: 381 RSLLSGCRIYGNRELGQWTAEKLLSLAPQNLATHVLLS 418 >ref|XP_004171410.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Length = 172 Score = 128 bits (321), Expect = 6e-28 Identities = 56/98 (57%), Positives = 77/98 (78%) Frame = -2 Query: 506 HLGLVELGCSFFDSISSVYKMVPSEENFGSLVDLFSRNGFLEEAKHVLEVMPFAPWPAVW 327 H+GLVE G S F ++ S Y M PS +N+G LVD+ SRNGFL +A++++E MPF+PWPA+ Sbjct: 40 HMGLVEQGRSLFQTMKSDYNMTPSRDNYGCLVDMLSRNGFLYDARYIIESMPFSPWPAIL 99 Query: 326 RSILNGCRIHGNRNLGEWASKHLLQLVPKNDAAYVLLS 213 RS+L+GCRI+GNR LG+W ++ LL L P+N A +VLLS Sbjct: 100 RSLLSGCRIYGNRELGQWTAEKLLSLAPQNLATHVLLS 137 >ref|XP_004147136.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39530-like [Cucumis sativus] Length = 638 Score = 128 bits (321), Expect = 6e-28 Identities = 56/98 (57%), Positives = 77/98 (78%) Frame = -2 Query: 506 HLGLVELGCSFFDSISSVYKMVPSEENFGSLVDLFSRNGFLEEAKHVLEVMPFAPWPAVW 327 H+GLVE G S F ++ S Y M PS +N+G LVD+ SRNGFL +A++++E MPF+PWPA+ Sbjct: 506 HMGLVEQGRSLFQTMKSDYNMTPSRDNYGCLVDMLSRNGFLYDARYIIESMPFSPWPAIL 565 Query: 326 RSILNGCRIHGNRNLGEWASKHLLQLVPKNDAAYVLLS 213 RS+L+GCRI+GNR LG+W ++ LL L P+N A +VLLS Sbjct: 566 RSLLSGCRIYGNRELGQWTAEKLLSLAPQNLATHVLLS 603