BLASTX nr result
ID: Coptis24_contig00031379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031379 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6,... 78 6e-13 emb|CBI20465.3| unnamed protein product [Vitis vinifera] 77 1e-12 ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthe... 77 1e-12 ref|XP_002316954.1| GH3 family protein [Populus trichocarpa] gi|... 74 1e-11 ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|... 73 3e-11 >ref|XP_002533739.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] gi|223526345|gb|EEF28642.1| Indole-3-acetic acid-amido synthetase GH3.6, putative [Ricinus communis] Length = 612 Score = 78.2 bits (191), Expect = 6e-13 Identities = 40/60 (66%), Positives = 46/60 (76%) Frame = -3 Query: 181 MPEAPKKTSVLPRNDEMMDYSLSEKNKKTLQFIEDVTSNPDDVQKRVLAEITTSNAHVEY 2 MPEAPK + + DY+LSEKN+KTLQFIEDVTSNPD+VQK+VL EI T NA VEY Sbjct: 1 MPEAPKNSLI------SSDYNLSEKNRKTLQFIEDVTSNPDEVQKKVLEEILTRNARVEY 54 >emb|CBI20465.3| unnamed protein product [Vitis vinifera] Length = 569 Score = 77.0 bits (188), Expect = 1e-12 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = -3 Query: 181 MPEAPKKTSVLPRNDEMMDYSLSEKNKKTLQFIEDVTSNPDDVQKRVLAEITTSNAHVEY 2 MPEAPKK+ +D Y L+EKNKK LQFIEDVT+N D VQKRVLAEI T NAHVEY Sbjct: 1 MPEAPKKSFKATGHD----YCLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEY 56 >ref|XP_002283229.1| PREDICTED: indole-3-acetic acid-amido synthetase GH3.6 isoform 1 [Vitis vinifera] gi|147866579|emb|CAN83696.1| hypothetical protein VITISV_013365 [Vitis vinifera] Length = 613 Score = 77.0 bits (188), Expect = 1e-12 Identities = 41/60 (68%), Positives = 45/60 (75%) Frame = -3 Query: 181 MPEAPKKTSVLPRNDEMMDYSLSEKNKKTLQFIEDVTSNPDDVQKRVLAEITTSNAHVEY 2 MPEAPKK+ +D Y L+EKNKK LQFIEDVT+N D VQKRVLAEI T NAHVEY Sbjct: 1 MPEAPKKSFKATGHD----YCLAEKNKKALQFIEDVTTNADQVQKRVLAEILTRNAHVEY 56 >ref|XP_002316954.1| GH3 family protein [Populus trichocarpa] gi|222860019|gb|EEE97566.1| GH3 family protein [Populus trichocarpa] Length = 611 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = -3 Query: 181 MPEAPKKTSVLPRNDEMMDYSLSEKNKKTLQFIEDVTSNPDDVQKRVLAEITTSNAHVEY 2 MPEAPK T + DY+L+EKNKK+LQFIEDVTSN D+ QK+VL EI + NAHVEY Sbjct: 1 MPEAPKNTL------KPSDYNLAEKNKKSLQFIEDVTSNADEAQKKVLEEILSRNAHVEY 54 >ref|XP_002319260.1| GH3 family protein [Populus trichocarpa] gi|222857636|gb|EEE95183.1| GH3 family protein [Populus trichocarpa] Length = 611 Score = 72.8 bits (177), Expect = 3e-11 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = -3 Query: 181 MPEAPKKTSVLPRNDEMMDYSLSEKNKKTLQFIEDVTSNPDDVQKRVLAEITTSNAHVEY 2 MPEAPK T + DY+L+EKNK +LQFIEDVTSN D+VQK+VL EI + NAHVEY Sbjct: 1 MPEAPKNTL------KTSDYNLAEKNKISLQFIEDVTSNADEVQKKVLEEILSRNAHVEY 54