BLASTX nr result
ID: Coptis24_contig00031217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031217 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|2... 96 2e-18 ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containi... 96 3e-18 ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_002879744.1| pentatricopeptide repeat-containing protein ... 87 1e-15 ref|XP_003623530.1| Pentatricopeptide repeat-containing protein ... 84 9e-15 >ref|XP_002309173.1| predicted protein [Populus trichocarpa] gi|222855149|gb|EEE92696.1| predicted protein [Populus trichocarpa] Length = 506 Score = 96.3 bits (238), Expect = 2e-18 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 8/106 (7%) Frame = -1 Query: 301 TPYKGKWQQTFNQQQAMEALKEAA------NNDEKP-LVSVLVNSFEMYACEPTPYAYSF 143 +PYK +W + FNQQQAM++LK++A + KP L+S L++SF +Y EP P A+ F Sbjct: 23 SPYKARWHRIFNQQQAMQSLKQSALKPPQQESPNKPHLLSSLIHSFSIYDVEPAPKAFDF 82 Query: 142 VVKSLFKSSQLDQLPCVLDHMRN-ERFEPPERIFVEIIRIYGCENR 8 + K+L K+SQ +P VLDH+ E FEPPE F +I +YG N+ Sbjct: 83 IFKTLVKTSQFHHIPSVLDHLEKVESFEPPESTFAYLIEVYGRTNK 128 >ref|XP_004137893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] gi|449483740|ref|XP_004156675.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Cucumis sativus] Length = 491 Score = 95.9 bits (237), Expect = 3e-18 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 2/100 (2%) Frame = -1 Query: 295 YKGKWQQTFNQQQAMEALKEAANNDEKPLV-SVLVNSFEMYACEPTPYAYSFVVKSLFKS 119 +K KW QTF+Q +A+ LK+AAN D+ L+ S LV SF Y+C PTP AY FV+K+L ++ Sbjct: 26 HKTKWHQTFDQDEALRILKQAANPDQPHLLLSALVTSFTAYSCHPTPNAYYFVLKTLART 85 Query: 118 SQLDQLPCVLDHMR-NERFEPPERIFVEIIRIYGCENRIR 2 SQ +P VL ++ E F+ PE IFV++I++YG NRI+ Sbjct: 86 SQFHHIPPVLHRLQFLENFQTPEYIFVDLIKLYGRMNRIQ 125 >ref|XP_003533674.1| PREDICTED: pentatricopeptide repeat-containing protein At2g38420, mitochondrial-like [Glycine max] Length = 499 Score = 87.4 bits (215), Expect = 1e-15 Identities = 46/113 (40%), Positives = 72/113 (63%), Gaps = 13/113 (11%) Frame = -1 Query: 301 TPYKGKWQQTFNQQQAMEALKEA------ANNDEKP------LVSVLVNSFEMYACEPTP 158 +PYK W F ++QAM+ LK+A + + ++P L+S L++SF+ Y+ +PTP Sbjct: 23 SPYKTSWHHNFGEEQAMKNLKQATLEMDSSQHPQRPNLPCPFLLSTLLDSFKAYSIDPTP 82 Query: 157 YAYSFVVKSLFKSSQLDQLPCVLDHMRN-ERFEPPERIFVEIIRIYGCENRIR 2 AY FV+K+L +SQL +P VL H+ + E+FE PE I V +IR YG +R++ Sbjct: 83 KAYFFVLKTLTSTSQLQDIPPVLYHLEHLEKFETPESILVYLIRFYGLSDRVQ 135 >ref|XP_002879744.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297325583|gb|EFH56003.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 444 Score = 87.4 bits (215), Expect = 1e-15 Identities = 42/100 (42%), Positives = 67/100 (67%), Gaps = 3/100 (3%) Frame = -1 Query: 295 YKGKWQQTFNQQQAMEALKE--AANNDEKPLVSVLVNSFEMYACEPTPYAYSFVVKSLFK 122 +K KW + Q+ AME L+ A+++ ++ LV+SF+++ CEPTP AY FV+++L K Sbjct: 16 FKTKWNENLKQKYAMEELRSNLLADSENGSVMRTLVSSFQLHNCEPTPQAYRFVIETLAK 75 Query: 121 SSQLDQLPCVLDHMR-NERFEPPERIFVEIIRIYGCENRI 5 +SQL+ + VLDH+ +E+F+ PE IF ++I YG RI Sbjct: 76 TSQLENIASVLDHLEVSEKFDTPESIFRDVIAAYGFSGRI 115 >ref|XP_003623530.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355498545|gb|AES79748.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 653 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/107 (39%), Positives = 70/107 (65%), Gaps = 7/107 (6%) Frame = -1 Query: 301 TPYKGKWQQTFNQQQAMEALKEAA----NNDEKPLVSVLVNSFEMYACEPTPYAYSFVVK 134 +PYK W F +QQA++ L A NN++ L+S L++SF+ Y +P+P AY F++K Sbjct: 23 SPYKTSWHHNFGEQQAIQILINAKTQTQNNNDPFLLSTLIHSFKAYHTDPSPKAYFFLIK 82 Query: 133 SL--FKSSQLDQLPCVLDHM-RNERFEPPERIFVEIIRIYGCENRIR 2 ++ +S L ++P +L+H+ NE+FE PE IF+ +IR YG +R++ Sbjct: 83 TITNINTSHLHEIPHILNHLEHNEKFETPEFIFMYLIRFYGFNDRVQ 129