BLASTX nr result
ID: Coptis24_contig00031121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031121 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521606.1| ISWI chromatin remodeling complex ATPase ISW... 61 8e-08 ref|XP_002267239.2| PREDICTED: ATP-dependent DNA helicase DDM1-l... 61 1e-07 emb|CBI17533.3| unnamed protein product [Vitis vinifera] 61 1e-07 emb|CAN81246.1| hypothetical protein VITISV_014031 [Vitis vinifera] 61 1e-07 ref|XP_002310223.1| chromatin remodeling complex subunit [Populu... 58 9e-07 >ref|XP_002521606.1| ISWI chromatin remodeling complex ATPase ISW1, putative [Ricinus communis] gi|223539284|gb|EEF40877.1| ISWI chromatin remodeling complex ATPase ISW1, putative [Ricinus communis] Length = 788 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -2 Query: 97 GNCMKGKLNNLMIQLRKKCSHPDLLESAFDGS 2 G+ MKGKLNNLMIQLRK C+HPDLLESAFDGS Sbjct: 497 GHGMKGKLNNLMIQLRKNCNHPDLLESAFDGS 528 >ref|XP_002267239.2| PREDICTED: ATP-dependent DNA helicase DDM1-like [Vitis vinifera] Length = 759 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 100 TGNCMKGKLNNLMIQLRKKCSHPDLLESAFDGS 2 TG +KGKLNNLM+QLRK C+HPDLLESAFDGS Sbjct: 467 TGRGVKGKLNNLMVQLRKNCNHPDLLESAFDGS 499 >emb|CBI17533.3| unnamed protein product [Vitis vinifera] Length = 800 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 100 TGNCMKGKLNNLMIQLRKKCSHPDLLESAFDGS 2 TG +KGKLNNLM+QLRK C+HPDLLESAFDGS Sbjct: 508 TGRGVKGKLNNLMVQLRKNCNHPDLLESAFDGS 540 >emb|CAN81246.1| hypothetical protein VITISV_014031 [Vitis vinifera] Length = 716 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 100 TGNCMKGKLNNLMIQLRKKCSHPDLLESAFDGS 2 TG +KGKLNNLM+QLRK C+HPDLLESAFDGS Sbjct: 404 TGRGVKGKLNNLMVQLRKNCNHPDLLESAFDGS 436 >ref|XP_002310223.1| chromatin remodeling complex subunit [Populus trichocarpa] gi|222853126|gb|EEE90673.1| chromatin remodeling complex subunit [Populus trichocarpa] Length = 754 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -2 Query: 100 TGNCMKGKLNNLMIQLRKKCSHPDLLESAFDGS 2 TG MKG+L NLM+QLRK C HPDLLESAFDGS Sbjct: 461 TGRGMKGRLTNLMVQLRKNCYHPDLLESAFDGS 493