BLASTX nr result
ID: Coptis24_contig00031076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031076 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523004.1| Syntaxin-81, putative [Ricinus communis] gi|... 55 8e-06 >ref|XP_002523004.1| Syntaxin-81, putative [Ricinus communis] gi|223537816|gb|EEF39434.1| Syntaxin-81, putative [Ricinus communis] Length = 309 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = +1 Query: 4 ASILASITMHKSRQKLPLLN--MPSVG-IEALELFIIKHRKDYVHSHRTTEQ*R 156 A+I+AS +HK RQ+ P + ++G IE LE FI+KHRKDYV HRTTEQ R Sbjct: 30 AAIMASFIIHKPRQRSPFTKAALTTLGSIETLEQFILKHRKDYVDLHRTTEQER 83