BLASTX nr result
ID: Coptis24_contig00031045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031045 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 emb|CBI40590.3| unnamed protein product [Vitis vinifera] 64 1e-08 emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] 64 1e-08 ref|XP_002301427.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 gb|AFW86094.1| hypothetical protein ZEAMMB73_140838 [Zea mays] 57 2e-06 >ref|XP_003633947.1| PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Vitis vinifera] Length = 512 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 331 FIEVDGIVHKFFVEDRSHPRSDEVYALLDEILCRMKLLCLESDLDSEIE 185 FIE G +HKF VEDRSH RSDE+YALLDE+ +MKL +D DSEIE Sbjct: 458 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSDSEIE 506 >emb|CBI40590.3| unnamed protein product [Vitis vinifera] Length = 495 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 331 FIEVDGIVHKFFVEDRSHPRSDEVYALLDEILCRMKLLCLESDLDSEIE 185 FIE G +HKF VEDRSH RSDE+YALLDE+ +MKL +D DSEIE Sbjct: 415 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSDSEIE 463 >emb|CAN66974.1| hypothetical protein VITISV_022076 [Vitis vinifera] Length = 967 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -3 Query: 331 FIEVDGIVHKFFVEDRSHPRSDEVYALLDEILCRMKLLCLESDLDSEIE 185 FIE G +HKF VEDRSH RSDE+YALLDE+ +MKL +D DSEIE Sbjct: 913 FIEEGGHIHKFIVEDRSHSRSDEIYALLDEVSMKMKLHGNVNDSDSEIE 961 >ref|XP_002301427.1| predicted protein [Populus trichocarpa] gi|222843153|gb|EEE80700.1| predicted protein [Populus trichocarpa] Length = 442 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = -3 Query: 328 IEVDGIVHKFFVEDRSHPRSDEVYALLDEILCRMKLLCLESDLDSEIE 185 IE +G +HKF VED+SHPR E+YALL+EI +MKL E D E+E Sbjct: 387 IEGEGEIHKFIVEDKSHPRHYEIYALLNEISTKMKLQITEDDFKPELE 434 >gb|AFW86094.1| hypothetical protein ZEAMMB73_140838 [Zea mays] Length = 508 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 331 FIEVDGIVHKFFVEDRSHPRSDEVYALLDEILCRMKLLCLES 206 FIE+DG +HKF VED+SHPRS++VY LD I MKL+ LE+ Sbjct: 462 FIELDGRMHKFLVEDKSHPRSEKVYDALDSITLAMKLVSLEN 503