BLASTX nr result
ID: Coptis24_contig00031017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031017 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ22096.1| ribosomal protein L16 [Cycas taitungensis] 82 6e-14 ref|YP_005090456.1| ribosomal protein L16 (mitochondrion) [Mille... 81 8e-14 ref|YP_005090475.1| ribosomal protein L16 (mitochondrion) [Lotus... 81 8e-14 sp|Q95747.3|RM16_ARATH RecName: Full=60S ribosomal protein L16, ... 80 1e-13 gb|ACD46918.1| ribosomal protein L16 [Ginkgo biloba] 80 2e-13 >dbj|BAJ22096.1| ribosomal protein L16 [Cycas taitungensis] Length = 177 Score = 81.6 bits (200), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -3 Query: 280 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 161 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS Sbjct: 138 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 177 >ref|YP_005090456.1| ribosomal protein L16 (mitochondrion) [Millettia pinnata] gi|358748147|gb|AET62916.1| ribosomal protein L16 (mitochondrion) [Millettia pinnata] Length = 185 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 280 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 161 RVSTGQ+LFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS Sbjct: 146 RVSTGQVLFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 185 >ref|YP_005090475.1| ribosomal protein L16 (mitochondrion) [Lotus japonicus] gi|358748144|gb|AET62935.1| ribosomal protein L16 (mitochondrion) [Lotus japonicus] Length = 185 Score = 81.3 bits (199), Expect = 8e-14 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 280 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 161 RVSTGQ+LFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS Sbjct: 146 RVSTGQVLFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 185 >sp|Q95747.3|RM16_ARATH RecName: Full=60S ribosomal protein L16, mitochondrial Length = 179 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 280 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 161 RVSTGQILFEMDGVSL+NARQAATLAAHKLCLSTKFVQWS Sbjct: 140 RVSTGQILFEMDGVSLANARQAATLAAHKLCLSTKFVQWS 179 >gb|ACD46918.1| ribosomal protein L16 [Ginkgo biloba] Length = 150 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -3 Query: 280 RVSTGQILFEMDGVSLSNARQAATLAAHKLCLSTKFVQWS 161 RVSTGQILFEMDGVSLS+ARQAATLAAHKLCLSTKFVQWS Sbjct: 111 RVSTGQILFEMDGVSLSDARQAATLAAHKLCLSTKFVQWS 150